PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Do025993.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; PACMAD clade; Panicoideae; Panicodae; Paniceae; Dichantheliinae; Dichanthelium
Family NAC
Protein Properties Length: 313aa    MW: 35109 Da    PI: 6.8708
Description NAC family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Do025993.1genomeDichanView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1NAM165.32.2e-51281601129
         NAM   1 lppGfrFhPtdeelvveyLkkkvegkkleleevikevdiykvePwdLpkkvkaeekewyfFskrdkkyatgkrknratksgyWkatgkdkevlskkgel 99 
                 lppGfrF P+dee++++yL +kv+++++++  +i evd +++ePw+L  ++k +ekewyfF+k+d+ky++g+r nrat+sgyWkatgkdke+++++  +
  Do025993.1  28 LPPGFRFYPRDEEIITFYLMPKVHQRNFTC-AIIGEVDFNRTEPWELSGNAKIGEKEWYFFCKKDRKYTKGTRMNRATESGYWKATGKDKEIYTSTIGA 125
                 79**************************99.88**************9888999****************************************73333 PP

         NAM 100 .....vglkktLvfykgrapkgektdWvmheyrle 129
                      +g+kktLvfykgrapkgekt W+mhe+rle
  Do025993.1 126 vfpllIGMKKTLVFYKGRAPKGEKTYWIMHEFRLE 160
                 56777***************************985 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF1019414.45E-5825195IPR003441NAC domain
PROSITE profilePS5100554.92128195IPR003441NAC domain
PfamPF023651.1E-2629159IPR003441NAC domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 313 aa     Download sequence    Send to blast
LLVILRAMGE HPEQPQGMNG GSDGGLELPP GFRFYPRDEE IITFYLMPKV HQRNFTCAII  60
GEVDFNRTEP WELSGNAKIG EKEWYFFCKK DRKYTKGTRM NRATESGYWK ATGKDKEIYT  120
STIGAVFPLL IGMKKTLVFY KGRAPKGEKT YWIMHEFRLE GNGRLPCPTS SSTSSTTMKS  180
CASEDDWVVC RVFRKTTGRA HALPPYNLAM ASDRIDKRSI PVPMPLQFPM LSDFTMDPVA  240
SYYSTIGASS AGMDSVGLHI NNTLFGNTMA MAPAMSFYHQ MDMGAASIND FMAAPEDQTF  300
VDGVTDEGHR DEQ
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1ut4_A7e-482619715167NO APICAL MERISTEM PROTEIN
1ut4_B7e-482619715167NO APICAL MERISTEM PROTEIN
1ut7_A7e-482619715167NO APICAL MERISTEM PROTEIN
1ut7_B7e-482619715167NO APICAL MERISTEM PROTEIN
3swm_A7e-482619718170NAC domain-containing protein 19
3swm_B7e-482619718170NAC domain-containing protein 19
3swm_C7e-482619718170NAC domain-containing protein 19
3swm_D7e-482619718170NAC domain-containing protein 19
3swp_A7e-482619718170NAC domain-containing protein 19
3swp_B7e-482619718170NAC domain-containing protein 19
3swp_C7e-482619718170NAC domain-containing protein 19
3swp_D7e-482619718170NAC domain-containing protein 19
4dul_A7e-482619715167NAC domain-containing protein 19
4dul_B7e-482619715167NAC domain-containing protein 19
Search in ModeBase
Functional Description ? help Back to Top
Source Description
UniProtBinds to the promoter regions of genes involved in chlorophyll catabolic processes, such as NYC1, SGR1, SGR2 and PAO. {ECO:0000269|PubMed:27021284}.
Cis-element ? help Back to Top
SourceLink
PlantRegMapDo025993.1
Regulation -- Description ? help Back to Top
Source Description
UniProtINDUCTION: Repressed by the microRNA miR164. {ECO:0000269|PubMed:15294871, ECO:0000269|PubMed:17098808}.
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_025801540.11e-132NAC domain-containing protein 79-like
SwissprotQ9FLJ28e-64NC100_ARATH; NAC domain-containing protein 100
TrEMBLA0A1E5UP530.0A0A1E5UP53_9POAL; NAC domain-containing protein 100 (Fragment)
STRINGPavir.Eb00839.1.p1e-140(Panicum virgatum)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP145237121
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G61430.12e-65NAC domain containing protein 100
Publications ? help Back to Top
  1. Duarte JM, et al.
    Expression pattern shifts following duplication indicative of subfunctionalization and neofunctionalization in regulatory genes of Arabidopsis.
    Mol. Biol. Evol., 2006. 23(2): p. 469-78
    [PMID:16280546]