PlantRegMap/PlantTFDB v5.0
Plant Transcription
Factor Database
|
Home TFext BLAST Prediction Download Help About Links PlantRegMap |
Transcription Factor Information
Basic Information? help Back to Top | |||||||||
---|---|---|---|---|---|---|---|---|---|
TF ID | Do025870.1 | ||||||||
Organism | |||||||||
Taxonomic ID | |||||||||
Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; PACMAD clade; Panicoideae; Panicodae; Paniceae; Dichantheliinae; Dichanthelium
|
||||||||
Family | GATA | ||||||||
Protein Properties | Length: 152aa MW: 16786.1 Da PI: 10.386 | ||||||||
Description | GATA family protein | ||||||||
Gene Model |
|
Signature Domain? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
No. | Domain | Score | E-value | Start | End | HMM Start | HMM End |
1 | GATA | 56.8 | 3.1e-18 | 28 | 62 | 1 | 35 |
GATA 1 CsnCgttkTplWRrgpdgnktLCnaCGlyyrkkgl 35 C+ C+ttkTplWR gp g+ +LCnaCG++yrkk++ Do025870.1 28 CTECHTTKTPLWRGGPCGPMSLCNACGIRYRKKRR 62 ********************************986 PP |
Protein Features ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Database | Entry ID | E-value | Start | End | InterPro ID | Description |
SuperFamily | SSF57716 | 1.05E-13 | 21 | 61 | No hit | No description |
SMART | SM00401 | 3.3E-14 | 22 | 75 | IPR000679 | Zinc finger, GATA-type |
PROSITE profile | PS50114 | 12.571 | 22 | 58 | IPR000679 | Zinc finger, GATA-type |
Gene3D | G3DSA:3.30.50.10 | 2.8E-14 | 26 | 62 | IPR013088 | Zinc finger, NHR/GATA-type |
CDD | cd00202 | 4.97E-14 | 27 | 62 | No hit | No description |
Pfam | PF00320 | 5.2E-16 | 28 | 62 | IPR000679 | Zinc finger, GATA-type |
PROSITE pattern | PS00344 | 0 | 28 | 53 | IPR000679 | Zinc finger, GATA-type |
Gene Ontology ? help Back to Top | ||||||
---|---|---|---|---|---|---|
GO Term | GO Category | GO Description | ||||
GO:0006355 | Biological Process | regulation of transcription, DNA-templated | ||||
GO:0003700 | Molecular Function | transcription factor activity, sequence-specific DNA binding | ||||
GO:0008270 | Molecular Function | zinc ion binding | ||||
GO:0043565 | Molecular Function | sequence-specific DNA binding |
Sequence ? help Back to Top |
---|
Protein Sequence Length: 152 aa Download sequence Send to blast |
MDSSVDKQQG SGSPDPDERP ASGEPKACTE CHTTKTPLWR GGPCGPMSLC NACGIRYRKK 60 RREALGLDAN KAAGGEQQQQ QRKKKTAAAA SSKREREKEA EADEVTVELR TVGFGKEVVL 120 KQRRRMRRRR RLGEEERAAI LLMALSSGVV YA |
Nucleic Localization Signal ? help Back to Top | |||
---|---|---|---|
No. | Start | End | Sequence |
1 | 121 | 127 | QRRRMRR |
2 | 123 | 128 | RRMRRR |
3 | 123 | 130 | RRMRRRRR |
Binding Motif ? help Back to Top | |||
---|---|---|---|
Motif ID | Method | Source | Motif file |
MP00554 | DAP | Transfer from AT5G49300 | Download |
Cis-element ? help Back to Top | |
---|---|
Source | Link |
PlantRegMap | Do025870.1 |
Regulation -- PlantRegMap ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Upstream Regulator | Target Gene | ||||
PlantRegMap | Retrieve | Retrieve |
Annotation -- Nucleotide ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | |||
GenBank | KJ728013 | 1e-110 | KJ728013.1 Zea mays clone pUT6148 C2C2-GATA transcription factor (GATA18) mRNA, partial cds. |
Annotation -- Protein ? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | ||||
Refseq | XP_025794899.1 | 2e-69 | GATA transcription factor 16-like isoform X1 | ||||
TrEMBL | A0A1E5US09 | 1e-105 | A0A1E5US09_9POAL; Uncharacterized protein | ||||
STRING | Pavir.J03766.1.p | 4e-80 | (Panicum virgatum) |
Orthologous Group ? help Back to Top | |||
---|---|---|---|
Lineage | Orthologous Group ID | Taxa Number | Gene Number |
Monocots | OGMP2418 | 38 | 92 |
Best hit in Arabidopsis thaliana ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Hit ID | E-value | Description | ||||
AT5G26930.1 | 3e-18 | GATA transcription factor 23 |