PlantRegMap/PlantTFDB v5.0
Plant Transcription
Factor Database
|
Home TFext BLAST Prediction Download Help About Links PlantRegMap |
Transcription Factor Information
Basic Information? help Back to Top | |||||||||
---|---|---|---|---|---|---|---|---|---|
TF ID | Do024046.1 | ||||||||
Organism | |||||||||
Taxonomic ID | |||||||||
Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; PACMAD clade; Panicoideae; Panicodae; Paniceae; Dichantheliinae; Dichanthelium
|
||||||||
Family | MYB_related | ||||||||
Protein Properties | Length: 189aa MW: 21259.5 Da PI: 7.3241 | ||||||||
Description | MYB_related family protein | ||||||||
Gene Model |
|
Signature Domain? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
No. | Domain | Score | E-value | Start | End | HMM Start | HMM End |
1 | Myb_DNA-binding | 44.8 | 2.9e-14 | 122 | 166 | 3 | 47 |
SS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHH CS Myb_DNA-binding 3 rWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqky 47 +W++eE+ l++++ +++G g+W+ I+r +Rt+ q+ s+ qky Do024046.1 122 PWSEEEHRLFLQGLEKYGRGDWRNISRFSVRTRTPTQVASHAQKY 166 7*******************************************9 PP |
Protein Features ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Database | Entry ID | E-value | Start | End | InterPro ID | Description |
PROSITE profile | PS50090 | 6.69 | 16 | 70 | IPR017877 | Myb-like domain |
Gene3D | G3DSA:1.10.10.60 | 3.6E-5 | 19 | 69 | IPR009057 | Homeodomain-like |
SuperFamily | SSF46689 | 2.44E-10 | 19 | 69 | IPR009057 | Homeodomain-like |
SMART | SM00717 | 0.085 | 20 | 72 | IPR001005 | SANT/Myb domain |
CDD | cd00167 | 3.57E-4 | 23 | 61 | No hit | No description |
PROSITE profile | PS51294 | 17.879 | 114 | 171 | IPR017930 | Myb domain |
SuperFamily | SSF46689 | 2.15E-17 | 117 | 170 | IPR009057 | Homeodomain-like |
TIGRFAMs | TIGR01557 | 3.3E-17 | 119 | 170 | IPR006447 | Myb domain, plants |
SMART | SM00717 | 3.6E-11 | 119 | 169 | IPR001005 | SANT/Myb domain |
Gene3D | G3DSA:1.10.10.60 | 3.6E-12 | 122 | 171 | IPR009057 | Homeodomain-like |
CDD | cd00167 | 1.12E-11 | 122 | 167 | No hit | No description |
Pfam | PF00249 | 9.0E-12 | 122 | 166 | IPR001005 | SANT/Myb domain |
Gene Ontology ? help Back to Top | ||||||
---|---|---|---|---|---|---|
GO Term | GO Category | GO Description | ||||
GO:0003677 | Molecular Function | DNA binding |
Sequence ? help Back to Top |
---|
Protein Sequence Length: 189 aa Download sequence Send to blast |
MDFHNHQLHS VRAAGPPAVA ARPWSKAEDK VFEGALVMWP EHAPDRWALV AAQLPGRTPR 60 EAWEHYEALV ADVDLIERGA VDTPSSWDDD DEASGGGGEE GGPARRAGAD RPRREGRRPG 120 IPWSEEEHRL FLQGLEKYGR GDWRNISRFS VRTRTPTQVA SHAQKYFNRQ LNPASRDSKR 180 KSIHDITTP |
3D Structure ? help Back to Top | ||||||
---|---|---|---|---|---|---|
PDB ID | Evalue | Query Start | Query End | Hit Start | Hit End | Description |
2cjj_A | 4e-15 | 20 | 85 | 7 | 72 | RADIALIS |
Search in ModeBase |
Functional Description ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Description | |||||
UniProt | Involved in the dorsovental asymmetry of flowers. Promotes ventral identity. {ECO:0000269|PubMed:11937495, ECO:0000269|PubMed:9118809}. |
Cis-element ? help Back to Top | |
---|---|
Source | Link |
PlantRegMap | Do024046.1 |
Regulation -- PlantRegMap ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Upstream Regulator | Target Gene | ||||
PlantRegMap | Retrieve | - |
Annotation -- Nucleotide ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | |||
GenBank | HF679436 | 0.0 | HF679436.1 Saccharum hybrid cultivar Co 86032 mRNA for ScMYB30 protein. |
Annotation -- Protein ? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | ||||
Refseq | XP_004970674.1 | 1e-104 | transcription factor DIVARICATA | ||||
Swissprot | Q8S9H7 | 2e-47 | DIV_ANTMA; Transcription factor DIVARICATA | ||||
TrEMBL | A0A1E5UTG3 | 1e-134 | A0A1E5UTG3_9POAL; Transcription factor DIVARICATA | ||||
STRING | Si003047m | 1e-104 | (Setaria italica) |
Orthologous Group ? help Back to Top | |||
---|---|---|---|
Lineage | Orthologous Group ID | Taxa Number | Gene Number |
Monocots | OGMP2895 | 36 | 87 |
Best hit in Arabidopsis thaliana ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Hit ID | E-value | Description | ||||
AT5G58900.1 | 5e-43 | Homeodomain-like transcriptional regulator |
Publications ? help Back to Top | |||
---|---|---|---|
|