PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Do024046.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; PACMAD clade; Panicoideae; Panicodae; Paniceae; Dichantheliinae; Dichanthelium
Family MYB_related
Protein Properties Length: 189aa    MW: 21259.5 Da    PI: 7.3241
Description MYB_related family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Do024046.1genomeDichanView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding44.82.9e-14122166347
                      SS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHH CS
  Myb_DNA-binding   3 rWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqky 47 
                      +W++eE+ l++++ +++G g+W+ I+r    +Rt+ q+ s+ qky
       Do024046.1 122 PWSEEEHRLFLQGLEKYGRGDWRNISRFSVRTRTPTQVASHAQKY 166
                      7*******************************************9 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS500906.691670IPR017877Myb-like domain
Gene3DG3DSA:1.10.10.603.6E-51969IPR009057Homeodomain-like
SuperFamilySSF466892.44E-101969IPR009057Homeodomain-like
SMARTSM007170.0852072IPR001005SANT/Myb domain
CDDcd001673.57E-42361No hitNo description
PROSITE profilePS5129417.879114171IPR017930Myb domain
SuperFamilySSF466892.15E-17117170IPR009057Homeodomain-like
TIGRFAMsTIGR015573.3E-17119170IPR006447Myb domain, plants
SMARTSM007173.6E-11119169IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.603.6E-12122171IPR009057Homeodomain-like
CDDcd001671.12E-11122167No hitNo description
PfamPF002499.0E-12122166IPR001005SANT/Myb domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 189 aa     Download sequence    Send to blast
MDFHNHQLHS VRAAGPPAVA ARPWSKAEDK VFEGALVMWP EHAPDRWALV AAQLPGRTPR  60
EAWEHYEALV ADVDLIERGA VDTPSSWDDD DEASGGGGEE GGPARRAGAD RPRREGRRPG  120
IPWSEEEHRL FLQGLEKYGR GDWRNISRFS VRTRTPTQVA SHAQKYFNRQ LNPASRDSKR  180
KSIHDITTP
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
2cjj_A4e-152085772RADIALIS
Search in ModeBase
Functional Description ? help Back to Top
Source Description
UniProtInvolved in the dorsovental asymmetry of flowers. Promotes ventral identity. {ECO:0000269|PubMed:11937495, ECO:0000269|PubMed:9118809}.
Cis-element ? help Back to Top
SourceLink
PlantRegMapDo024046.1
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankHF6794360.0HF679436.1 Saccharum hybrid cultivar Co 86032 mRNA for ScMYB30 protein.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_004970674.11e-104transcription factor DIVARICATA
SwissprotQ8S9H72e-47DIV_ANTMA; Transcription factor DIVARICATA
TrEMBLA0A1E5UTG31e-134A0A1E5UTG3_9POAL; Transcription factor DIVARICATA
STRINGSi003047m1e-104(Setaria italica)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP28953687
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G58900.15e-43Homeodomain-like transcriptional regulator
Publications ? help Back to Top
  1. Galego L,Almeida J
    Role of DIVARICATA in the control of dorsoventral asymmetry in Antirrhinum flowers.
    Genes Dev., 2002. 16(7): p. 880-91
    [PMID:11937495]
  2. Almeida J,Rocheta M,Galego L
    Genetic control of flower shape in Antirrhinum majus.
    Development, 1997. 124(7): p. 1387-92
    [PMID:9118809]