PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Do014214.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; PACMAD clade; Panicoideae; Panicodae; Paniceae; Dichantheliinae; Dichanthelium
Family MYB
Protein Properties Length: 210aa    MW: 23018.4 Da    PI: 11.263
Description MYB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Do014214.1genomeDichanView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding46.86.7e-151965148
                     TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
  Myb_DNA-binding  1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48
                     +++WT+eEd  l + v+ +G+ +W++I++ ++  R +k+c++rw ++l
       Do014214.1 19 KKAWTKEEDAVLREQVRAHGPQNWAAISAALP-ERNPKSCRLRWCQHL 65
                     689*****************************.***********9986 PP

2Myb_DNA-binding48.61.8e-1574116347
                      SS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHH CS
  Myb_DNA-binding   3 rWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqky 47 
                      ++T+eEd+++++++++++++ W+tIa  ++ gR+++ +k+rw+++
       Do014214.1  74 PFTPEEDDKILHLHRLFPNK-WATIAGFLP-GRSDNAIKNRWNSV 116
                      79******************.*********.***********987 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5129420.781469IPR017930Myb domain
SMARTSM007176.0E-141867IPR001005SANT/Myb domain
SuperFamilySSF466892.09E-2919113IPR009057Homeodomain-like
Gene3DG3DSA:1.10.10.608.1E-181967IPR009057Homeodomain-like
PfamPF002494.9E-141965IPR001005SANT/Myb domain
CDDcd001671.92E-132165No hitNo description
SMARTSM007175.8E-1371119IPR001005SANT/Myb domain
PROSITE profilePS5129418.72673121IPR017930Myb domain
Gene3DG3DSA:1.10.10.608.7E-2074117IPR009057Homeodomain-like
CDDcd001672.87E-1274117No hitNo description
PfamPF002494.5E-1474117IPR001005SANT/Myb domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 210 aa     Download sequence    Send to blast
MAVPDDAAAA GGVRGEGTKK AWTKEEDAVL REQVRAHGPQ NWAAISAALP ERNPKSCRLR  60
WCQHLTPGVD AVRPFTPEED DKILHLHRLF PNKWATIAGF LPGRSDNAIK NRWNSVLSKQ  120
RRRLAAAAAP LCRLPDGTLP LFPLAPDDLR AFGRGAPAPS RTQPVDKGVD LSGACMNLFP  180
LAPGDLVRGT MRARRRGWMW TAAPTRRSPS
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
3zqc_A2e-28221205102MYB3
3zqc_D2e-28221205102MYB3
3zqc_G2e-28221205102MYB3
3zqc_J2e-28221205102MYB3
Search in ModeBase
Cis-element ? help Back to Top
SourceLink
PlantRegMapDo014214.1
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_004987088.12e-90transcription factor MYB1
TrEMBLA0A1E5W9P71e-149A0A1E5W9P7_9POAL; Transcription factor MYB44
STRINGSi039876m1e-89(Setaria italica)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP49603465
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G50060.11e-34myb domain protein 77