PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Do011059.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; PACMAD clade; Panicoideae; Panicodae; Paniceae; Dichantheliinae; Dichanthelium
Family MYB_related
Protein Properties Length: 139aa    MW: 16068.7 Da    PI: 11.0209
Description MYB_related family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Do011059.1genomeDichanView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding58.61.4e-1865112148
                      TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
  Myb_DNA-binding   1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48 
                      +g W++eEde+l + ++++G g+W+t+++  g+ R++k+c++rw +yl
       Do011059.1  65 KGLWSPEEDEKLMNHITKHGHGCWSTVPKLAGLQRCGKSCRLRWINYL 112
                      678*******************************************97 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:1.10.10.602.0E-2857115IPR009057Homeodomain-like
PROSITE profilePS5129424.58660116IPR017930Myb domain
SMARTSM007176.5E-1264114IPR001005SANT/Myb domain
PfamPF002498.4E-1665112IPR001005SANT/Myb domain
SuperFamilySSF466892.33E-2267139IPR009057Homeodomain-like
CDDcd001671.05E-1068112No hitNo description
Gene3DG3DSA:1.10.10.609.8E-9116139IPR009057Homeodomain-like
PROSITE profilePS512949.029117139IPR017930Myb domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 139 aa     Download sequence    Send to blast
MAIPRARVVK RGQLRFALRR DTGPMKKEYR SRGNHLYRRL QGSASASALL SMGRHSCCYK  60
QKLRKGLWSP EEDEKLMNHI TKHGHGCWST VPKLAGLQRC GKSCRLRWIN YLRPDLKRGA  120
FSQEEEDLII ELHAVLGNR
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1a5j_A9e-1663139580B-MYB
1h8a_C1e-156213924100MYB TRANSFORMING PROTEIN
Search in ModeBase
Functional Description ? help Back to Top
Source Description
UniProtTranscription factor that coordinates a small network of downstream target genes required for several aspects of plant growth and development, such as xylem formation and xylem cell differentiation, and lateral root formation (PubMed:22708996). Regulates a specific set of target genes by binding DNA to the AC cis-element 5'-ACCTAC-3' (PubMed:23741471). Functions as a transcriptional regulator of stomatal closure. Plays a role the regulation of stomatal pore size independently of abscisic acid (ABA) (PubMed:16005292). Required for seed coat mucilage deposition during the development of the seed coat epidermis (PubMed:19401413). Involved in the induction of trichome initiation and branching by positively regulating GL1 and GL2. Required for gibberellin (GA) biosynthesis and degradation by positively affecting the expression of the enzymes that convert GA9 into the bioactive GA4, as well as the enzymes involved in the degradation of GA4 (PubMed:28207974). {ECO:0000269|PubMed:16005292, ECO:0000269|PubMed:19401413, ECO:0000269|PubMed:22708996, ECO:0000269|PubMed:23741471, ECO:0000269|PubMed:28207974}.
Cis-element ? help Back to Top
SourceLink
PlantRegMapDo011059.1
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankHF6794171e-117HF679417.1 Saccharum hybrid cultivar Co 86032 mRNA for ScMYB11 protein.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqNP_001140269.11e-59uncharacterized protein LOC100272313
RefseqXP_021313187.15e-60transcription factor MYB61 isoform X2
SwissprotQ8VZQ27e-57MYB61_ARATH; Transcription factor MYB61
TrEMBLA0A1E5VVV84e-98A0A1E5VVV8_9POAL; Transcription factor MYB86
STRINGORGLA01G0100400.17e-60(Oryza glaberrima)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP30923385
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G09540.19e-59myb domain protein 61
Publications ? help Back to Top
  1. Heyndrickx KS,Vandepoele K
    Systematic identification of functional plant modules through the integration of complementary data sources.
    Plant Physiol., 2012. 159(3): p. 884-901
    [PMID:22589469]
  2. Matías-Hernández L, et al.
    AaMYB1 and its orthologue AtMYB61 affect terpene metabolism and trichome development in Artemisia annua and Arabidopsis thaliana.
    Plant J., 2017. 90(3): p. 520-534
    [PMID:28207974]