PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Do004760.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; PACMAD clade; Panicoideae; Panicodae; Paniceae; Dichantheliinae; Dichanthelium
Family MYB
Protein Properties Length: 354aa    MW: 37696.8 Da    PI: 6.6156
Description MYB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Do004760.1genomeDichanView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding53.74.6e-171461148
                     TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
  Myb_DNA-binding  1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48
                     rg W++eEde+l + ++++G g+W+++++  g+ R++k+c++rw +yl
       Do004760.1 14 RGLWSPEEDEKLMNHIAKYGHGCWSSVPKLAGLERCGKSCRLRWINYL 61
                     788*******************************************97 PP

2Myb_DNA-binding53.55.7e-1767111147
                      TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHH CS
  Myb_DNA-binding   1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqky 47 
                      rg++++eE++l+++++ +lG++ W+ Ia+ ++ gRt++++k++w++y
       Do004760.1  67 RGAFSQEEEDLIIHLHSMLGNK-WSQIAAQLP-GRTDNEVKNFWNSY 111
                      89********************.*********.************98 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:1.10.10.601.2E-25964IPR009057Homeodomain-like
PROSITE profilePS5129419.139961IPR017930Myb domain
SuperFamilySSF466895.24E-3012108IPR009057Homeodomain-like
SMARTSM007173.1E-131363IPR001005SANT/Myb domain
PfamPF002491.4E-151461IPR001005SANT/Myb domain
CDDcd001674.46E-121761No hitNo description
PROSITE profilePS5129427.13862116IPR017930Myb domain
Gene3DG3DSA:1.10.10.602.3E-2665116IPR009057Homeodomain-like
SMARTSM007176.4E-1666114IPR001005SANT/Myb domain
PfamPF002495.9E-1667111IPR001005SANT/Myb domain
CDDcd001672.09E-1169112No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 354 aa     Download sequence    Send to blast
MARRTSGPKK KLRRGLWSPE EDEKLMNHIA KYGHGCWSSV PKLAGLERCG KSCRLRWINY  60
LRPDLKRGAF SQEEEDLIIH LHSMLGNKWS QIAAQLPGRT DNEVKNFWNS YIKKKLRQRG  120
IDPATHKLLA EASSSRGGAA AASSRTAVFS DAELILSSAA GQHMPPPPVT AESYVYSLSI  180
SADGGASDGS LQSLSGYNQT GDFAAGYLQD PDVLHCGPSG VPAVVLPSVS SSSTLNSMAD  240
LSPAATTATT GTDEQCNNNS SSGGGNGPFK PSTQQSCSAN QLPPWLELGT SGYANGAAAV  300
DQYGAALDEL KWSDYVFDGY GGGQYQQGQC IYGDSKDAVQ FVDANGLSSS WCLN
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1a5j_A2e-29121165108B-MYB
Search in ModeBase
Cis-element ? help Back to Top
SourceLink
PlantRegMapDo004760.1
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankKJ4773311e-161KJ477331.1 Indosasa hispida MYB transcription factor mRNA, complete cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_025802131.10.0transcription factor MYB61-like
TrEMBLA0A1E5UXC10.0A0A1E5UXC1_9POAL; Transcription factor MYB86
STRINGSi029872m0.0(Setaria italica)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP30923385
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G01680.36e-75myb domain protein 55