PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Do001152.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; PACMAD clade; Panicoideae; Panicodae; Paniceae; Dichantheliinae; Dichanthelium
Family NAC
Protein Properties Length: 381aa    MW: 42840.3 Da    PI: 7.779
Description NAC family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Do001152.1genomeDichanView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1NAM169.88.6e-53161431128
         NAM   1 lppGfrFhPtdeelvveyLkkkvegkkleleevikevdiykvePwdLpkkvkaeekewyfFskrdkkyatgkrknratksgyWkatgkdkevlsk.kge 98 
                 l+pGfrFhPtdeelv++yLkkk+++k++++ e ik++diyk++PwdLpk ++++ekewyf+++rd+ky+++ r+nr+t++g+Wkatg+d++++s+ +++
  Do001152.1  16 LMPGFRFHPTDEELVSFYLKKKIQQKPISI-ELIKQLDIYKFDPWDLPKLASTGEKEWYFYCPRDRKYRNSVRPNRVTAAGFWKATGTDRPIYSSeGTK 113
                 689***************************.89***************9888999***************************************95666 PP

         NAM  99 lvglkktLvfykgrapkgektdWvmheyrl 128
                  +glkk+Lvfykgra +g ktdW+mhe+rl
  Do001152.1 114 CIGLKKSLVFYKGRAARGMKTDWMMHEFRL 143
                 7***************************98 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF1019418.5E-5813174IPR003441NAC domain
PROSITE profilePS5100557.08216174IPR003441NAC domain
PfamPF023659.7E-2618143IPR003441NAC domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0009733Biological Processresponse to auxin
GO:0045770Biological Processpositive regulation of asymmetric cell division
GO:0048103Biological Processsomatic stem cell division
GO:0048829Biological Processroot cap development
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 381 aa     Download sequence    Send to blast
MEATNDINMD KSDEVLMPGF RFHPTDEELV SFYLKKKIQQ KPISIELIKQ LDIYKFDPWD  60
LPKLASTGEK EWYFYCPRDR KYRNSVRPNR VTAAGFWKAT GTDRPIYSSE GTKCIGLKKS  120
LVFYKGRAAR GMKTDWMMHE FRLPSLNDPS LPKRPIDKTI PLNDSWTICR IFKKNSSMAQ  180
RALSHTWGPP LPGATEAEMF SAFQSVQASE FALESSSCSL QVAPPAPASQ FTSRHGLQGQ  240
QQQQNKVNNP SLDGSSCKLI NFNCSQSLEP QNFPITFPFE VQTSQKTTAA APIFFSTQPE  300
HQLSGFVVDS SADFNGGIGS RSQESTRKPG NSFSMNSSDW EAVGKINFPF DLGADSSEEW  360
RCNIPWESFL SPAAVQTELP H
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1ut4_A8e-531617717168NO APICAL MERISTEM PROTEIN
1ut4_B8e-531617717168NO APICAL MERISTEM PROTEIN
1ut7_A8e-531617717168NO APICAL MERISTEM PROTEIN
1ut7_B8e-531617717168NO APICAL MERISTEM PROTEIN
4dul_A8e-531617717168NAC domain-containing protein 19
4dul_B8e-531617717168NAC domain-containing protein 19
Search in ModeBase
Functional Description ? help Back to Top
Source Description
UniProtPromotes periclinal root capforming cell divisions. Activates expression of its negative regulator SMB in a feedback loop for controlled switches in cell division plane. {ECO:0000269|PubMed:19081078}.
Cis-element ? help Back to Top
SourceLink
PlantRegMapDo001152.1
Regulation -- Description ? help Back to Top
Source Description
UniProtINDUCTION: Repressed by SMB in oriented-divised root cap stem cells. {ECO:0000269|PubMed:19081078}.
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_025822140.10.0protein FEZ-like
SwissprotQ9ZVH03e-96FEZ_ARATH; Protein FEZ
TrEMBLA0A1E5VQC20.0A0A1E5VQC2_9POAL; Protein FEZ
STRINGSi015514m0.0(Setaria italica)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP33663882
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G26870.12e-98NAC family protein
Publications ? help Back to Top
  1. Bennett T,van den Toorn A,Willemsen V,Scheres B
    Precise control of plant stem cell activity through parallel regulatory inputs.
    Development, 2014. 141(21): p. 4055-64
    [PMID:25256342]