PlantRegMap/PlantTFDB v5.0
Plant Transcription
Factor Database
|
Home TFext BLAST Prediction Download Help About Links PlantRegMap |
Transcription Factor Information
Basic Information? help Back to Top | |||||||||
---|---|---|---|---|---|---|---|---|---|
TF ID | KZV58766.1 | ||||||||
Organism | |||||||||
Taxonomic ID | |||||||||
Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Lamiales; Gesneriaceae; Didymocarpoideae; Trichosporeae; Loxocarpinae; Dorcoceras
|
||||||||
Family | Whirly | ||||||||
Protein Properties | Length: 157aa MW: 17696.3 Da PI: 5.929 | ||||||||
Description | Whirly family protein | ||||||||
Gene Model |
|
Signature Domain? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
No. | Domain | Score | E-value | Start | End | HMM Start | HMM End |
1 | Whirly | 67.6 | 2.3e-21 | 17 | 74 | 2 | 60 |
Whirly 2 vyktkaalkvkavrptfealdsgnlklkraGglllelanataerkydWekkqsfalsat 60 +yk+kaal v+++ p+f+ l+sg++kl+++G++ll++a+a+++r+ydW++kq+ alsa KZV58766.1 17 IYKGKAALAVEPRPPEFSPLESGAFKLSKEGFILLQFAPAAGVRQYDWSRKQE-ALSAL 74 9**************************************************97.56665 PP | |||||||
2 | Whirly | 21.8 | 3.2e-07 | 92 | 119 | 111 | 138 |
Whirly 111 vtnslvkgnesfsvPvskaefavlrsll 138 v+n+lv+++e++++P++kaefavl s + KZV58766.1 92 VQNKLVNVDENIYIPITKAEFAVLVSSF 119 89**********************9877 PP |
Protein Features ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Database | Entry ID | E-value | Start | End | InterPro ID | Description |
Gene3D | G3DSA:2.30.31.10 | 2.5E-27 | 5 | 74 | IPR009044 | ssDNA-binding transcriptional regulator |
SuperFamily | SSF54447 | 5.34E-45 | 9 | 156 | IPR009044 | ssDNA-binding transcriptional regulator |
Pfam | PF08536 | 1.5E-20 | 17 | 77 | IPR013742 | Plant transcription factor |
Gene3D | G3DSA:2.30.31.10 | 6.7E-15 | 91 | 142 | IPR009044 | ssDNA-binding transcriptional regulator |
Gene Ontology ? help Back to Top | ||||||
---|---|---|---|---|---|---|
GO Term | GO Category | GO Description | ||||
GO:0006281 | Biological Process | DNA repair | ||||
GO:0032211 | Biological Process | negative regulation of telomere maintenance via telomerase | ||||
GO:0045893 | Biological Process | positive regulation of transcription, DNA-templated | ||||
GO:0045910 | Biological Process | negative regulation of DNA recombination | ||||
GO:0009508 | Cellular Component | plastid chromosome | ||||
GO:0009570 | Cellular Component | chloroplast stroma | ||||
GO:0003697 | Molecular Function | single-stranded DNA binding | ||||
GO:0003700 | Molecular Function | transcription factor activity, sequence-specific DNA binding | ||||
GO:0003723 | Molecular Function | RNA binding | ||||
GO:0042162 | Molecular Function | telomeric DNA binding |
Sequence ? help Back to Top |
---|
Protein Sequence Length: 157 aa Download sequence Send to blast |
MFVAGQYPPR VYVGYTIYKG KAALAVEPRP PEFSPLESGA FKLSKEGFIL LQFAPAAGVR 60 QYDWSRKQEA LSALGLEILV NFFMILIKEE GVQNKLVNVD ENIYIPITKA EFAVLVSSFN 120 FILPCLLGWH TFANSTRPED ASRLNNANST VDYEWNR |
3D Structure ? help Back to Top | ||||||
---|---|---|---|---|---|---|
PDB ID | Evalue | Query Start | Query End | Hit Start | Hit End | Description |
1l3a_A | 3e-64 | 5 | 156 | 32 | 219 | p24: plant transcriptional regulator PBF-2 |
1l3a_B | 3e-64 | 5 | 156 | 32 | 219 | p24: plant transcriptional regulator PBF-2 |
1l3a_C | 3e-64 | 5 | 156 | 32 | 219 | p24: plant transcriptional regulator PBF-2 |
1l3a_D | 3e-64 | 5 | 156 | 32 | 219 | p24: plant transcriptional regulator PBF-2 |
Search in ModeBase |
Functional Description ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Description | |||||
UniProt | Single-stranded DNA-binding protein that acts as a transcriptional activator of the pathogenesis-related gene PR-10a. Upon elicitation, binds a 30bp promoter sequence known as elicitor element response (ERE) and is required for PR-10a expression. {ECO:0000269|PubMed:10948264, ECO:0000269|PubMed:12080340, ECO:0000269|PubMed:14960277}. |
Cis-element ? help Back to Top | |
---|---|
Source | Link |
PlantRegMap | KZV58766.1 |
Regulation -- PlantRegMap ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Upstream Regulator | Target Gene | ||||
PlantRegMap | Retrieve | - |
Annotation -- Protein ? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | ||||
Refseq | XP_012847743.1 | 9e-71 | PREDICTED: single-stranded DNA-binding protein WHY1, chloroplastic | ||||
Swissprot | Q9LL85 | 1e-64 | WHY1_SOLTU; Single-stranded DNA-binding protein WHY1, chloroplastic | ||||
TrEMBL | A0A2Z7DFX6 | 1e-112 | A0A2Z7DFX6_9LAMI; DNA-binding protein p24 | ||||
STRING | Migut.L01333.1.p | 3e-70 | (Erythranthe guttata) |
Orthologous Group ? help Back to Top | |||
---|---|---|---|
Lineage | Orthologous Group ID | Taxa Number | Gene Number |
Asterids | OGEA7731 | 24 | 30 |
Best hit in Arabidopsis thaliana ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Hit ID | E-value | Description | ||||
AT2G02740.2 | 3e-64 | ssDNA-binding transcriptional regulator |