PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID KZV55274.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Lamiales; Gesneriaceae; Didymocarpoideae; Trichosporeae; Loxocarpinae; Dorcoceras
Family MYB_related
Protein Properties Length: 217aa    MW: 25233.5 Da    PI: 9.9146
Description MYB_related family protein
Gene Model
Gene Model ID Type Source Coding Sequence
KZV55274.1genomeCNUView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding41.53.1e-13122166347
                      SS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHH CS
  Myb_DNA-binding   3 rWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqky 47 
                      +WT+eE+ l++ + k +G g+W++I+r +  ++t+ q+ s+ qky
       KZV55274.1 122 PWTEEEHRLFLIGLKTYGRGDWRSISRNVVVTKTPTQVASHAQKY 166
                      8*******************************************9 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM007170.0281264IPR001005SANT/Myb domain
CDDcd001678.00E-61562No hitNo description
SuperFamilySSF466892.14E-81566IPR009057Homeodomain-like
PROSITE profilePS500906.5511662IPR017877Myb-like domain
PROSITE profilePS5129418.692115171IPR017930Myb domain
SuperFamilySSF466892.28E-16117170IPR009057Homeodomain-like
TIGRFAMsTIGR015572.7E-17118170IPR006447Myb domain, plants
SMARTSM007171.7E-10119169IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.603.1E-10119165IPR009057Homeodomain-like
PfamPF002494.7E-11122166IPR001005SANT/Myb domain
CDDcd001673.47E-9122167No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 217 aa     Download sequence    Send to blast
MYANFPAMAL TFPATWNRRE DKIFENCLVE IPDFVENRWH MIARRIPGKS PEDVWAHYEA  60
LLFDVRQIDT GLVQPPRYPD ETVTRSLPGD YRPQLRDPGQ IWFASGPGRN RHVEVERKKG  120
RPWTEEEHRL FLIGLKTYGR GDWRSISRNV VVTKTPTQVA SHAQKYFLRQ YSRKEKKRSS  180
IHDITTATDS LTVPAQPNLP VPDQANSQSS QFKQEAM
Cis-element ? help Back to Top
SourceLink
PlantRegMapKZV55274.1
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_011084236.15e-78transcription factor SRM1-like
TrEMBLA0A2Z7D6M11e-161A0A2Z7D6M1_9LAMI; Transcription factor DIVARICATA
STRINGMigut.F01593.1.p1e-72(Erythranthe guttata)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
AsteridsOGEA45472241
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G04760.14e-57MYB family protein