PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID KZV55273.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Lamiales; Gesneriaceae; Didymocarpoideae; Trichosporeae; Loxocarpinae; Dorcoceras
Family MYB_related
Protein Properties Length: 209aa    MW: 23761.4 Da    PI: 8.4892
Description MYB_related family protein
Gene Model
Gene Model ID Type Source Coding Sequence
KZV55273.1genomeCNUView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding41.82.5e-13113157347
                      SS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHH CS
  Myb_DNA-binding   3 rWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqky 47 
                      +WT+eE+ l++ +  ++G+g+W++I+r +  +Rt+ q+ s+ qky
       KZV55273.1 113 PWTEEEHRLFLVGLDRFGKGDWRSISRNVVITRTPTQVASHAQKY 157
                      8*****************************99************9 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS500906.609155IPR017877Myb-like domain
SMARTSM007170.0067557IPR001005SANT/Myb domain
SuperFamilySSF466891.52E-8860IPR009057Homeodomain-like
CDDcd001676.24E-5955No hitNo description
PROSITE profilePS5129419.034106162IPR017930Myb domain
SuperFamilySSF466892.07E-16108162IPR009057Homeodomain-like
TIGRFAMsTIGR015573.9E-16109161IPR006447Myb domain, plants
Gene3DG3DSA:1.10.10.601.3E-10110155IPR009057Homeodomain-like
SMARTSM007174.8E-11110160IPR001005SANT/Myb domain
CDDcd001672.74E-9113157No hitNo description
PfamPF002494.0E-12113157IPR001005SANT/Myb domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 209 aa     Download sequence    Send to blast
MPRNSSAMWD RREDKVFENC LVEIPDTVEN RWQIIATRIP GKSPEDVLLH YEALLHDVGQ  60
IDAGLVEPPS YPDGTSSRGW DDRPRARDSG QISFGSGSSR SRHHEVERKK GTPWTEEEHR  120
LFLVGLDRFG KGDWRSISRN VVITRTPTQV ASHAQKYYIR QSAAKKERKR SSIHDITTAA  180
DSLTVPAQPN LPAPNQRSFQ DFQFQDAAL
Functional Description ? help Back to Top
Source Description
UniProtInvolved in the dorsovental asymmetry of flowers. Promotes ventral identity. {ECO:0000269|PubMed:11937495, ECO:0000269|PubMed:9118809}.
Cis-element ? help Back to Top
SourceLink
PlantRegMapKZV55273.1
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_011084236.11e-91transcription factor SRM1-like
SwissprotQ8S9H72e-55DIV_ANTMA; Transcription factor DIVARICATA
TrEMBLA0A2Z7D6Y61e-153A0A2Z7D6Y6_9LAMI; Transcription factor DIVARICATA
STRINGMigut.F01593.1.p1e-82(Erythranthe guttata)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
AsteridsOGEA45472241
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G04760.14e-61MYB family protein
Publications ? help Back to Top
  1. Galego L,Almeida J
    Role of DIVARICATA in the control of dorsoventral asymmetry in Antirrhinum flowers.
    Genes Dev., 2002. 16(7): p. 880-91
    [PMID:11937495]
  2. Almeida J,Rocheta M,Galego L
    Genetic control of flower shape in Antirrhinum majus.
    Development, 1997. 124(7): p. 1387-92
    [PMID:9118809]