PlantRegMap/PlantTFDB v5.0
Plant Transcription
Factor Database
|
Home TFext BLAST Prediction Download Help About Links PlantRegMap |
Transcription Factor Information
Basic Information? help Back to Top | |||||||||
---|---|---|---|---|---|---|---|---|---|
TF ID | KZV52255.1 | ||||||||
Organism | |||||||||
Taxonomic ID | |||||||||
Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Lamiales; Gesneriaceae; Didymocarpoideae; Trichosporeae; Loxocarpinae; Dorcoceras
|
||||||||
Family | MIKC_MADS | ||||||||
Protein Properties | Length: 216aa MW: 24325.7 Da PI: 8.6975 | ||||||||
Description | MIKC_MADS family protein | ||||||||
Gene Model |
|
Signature Domain? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
No. | Domain | Score | E-value | Start | End | HMM Start | HMM End |
1 | SRF-TF | 84.8 | 5e-27 | 10 | 59 | 2 | 51 |
---SHHHHHHHHHHHHHHHHHHHHHHHHHHT-EEEEEEE-TTSEEEEEE- CS SRF-TF 2 rienksnrqvtfskRrngilKKAeELSvLCdaevaviifsstgklyeyss 51 +i+n + rqvtfskRr g++KKA+ELSvLCdae+a+i+fs tgkl+++ss KZV52255.1 10 KIDNLTARQVTFSKRRRGLFKKAQELSVLCDAEIALIVFSATGKLFDFSS 59 69**********************************************96 PP | |||||||
2 | K-box | 40.6 | 1.1e-14 | 95 | 172 | 22 | 99 |
K-box 22 akLkkeienLqreqRhllGedLesLslkeLqqLeqqLekslkkiRskKnellleqieelqkkekelqeenkaLrkkle 99 + L+ke+ + + e+ +l+Ge+Le Lsl +L++Le+ +e +l+++ + K++ +l++i+ l+ ke el een +L+++ + KZV52255.1 95 DLLNKELAKRKIELQQLQGEELEGLSLDDLMRLEKFVEGGLSRVGKFKDDKFLNEISILKAKESELMEENARLKHQAK 172 557777777789999***********************************************************9865 PP |
Protein Features ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Database | Entry ID | E-value | Start | End | InterPro ID | Description |
SMART | SM00432 | 3.1E-38 | 1 | 60 | IPR002100 | Transcription factor, MADS-box |
PROSITE profile | PS50066 | 29.366 | 1 | 61 | IPR002100 | Transcription factor, MADS-box |
CDD | cd00265 | 3.88E-39 | 3 | 76 | No hit | No description |
SuperFamily | SSF55455 | 4.97E-30 | 3 | 78 | IPR002100 | Transcription factor, MADS-box |
PRINTS | PR00404 | 2.8E-26 | 3 | 23 | IPR002100 | Transcription factor, MADS-box |
PROSITE pattern | PS00350 | 0 | 3 | 57 | IPR002100 | Transcription factor, MADS-box |
Pfam | PF00319 | 2.2E-24 | 10 | 57 | IPR002100 | Transcription factor, MADS-box |
PRINTS | PR00404 | 2.8E-26 | 23 | 38 | IPR002100 | Transcription factor, MADS-box |
PRINTS | PR00404 | 2.8E-26 | 38 | 59 | IPR002100 | Transcription factor, MADS-box |
PROSITE profile | PS51297 | 10.714 | 87 | 180 | IPR002487 | Transcription factor, K-box |
Pfam | PF01486 | 8.3E-12 | 96 | 170 | IPR002487 | Transcription factor, K-box |
Gene Ontology ? help Back to Top | ||||||
---|---|---|---|---|---|---|
GO Term | GO Category | GO Description | ||||
GO:0006355 | Biological Process | regulation of transcription, DNA-templated | ||||
GO:0005634 | Cellular Component | nucleus | ||||
GO:0003677 | Molecular Function | DNA binding | ||||
GO:0003700 | Molecular Function | transcription factor activity, sequence-specific DNA binding | ||||
GO:0046983 | Molecular Function | protein dimerization activity |
Sequence ? help Back to Top |
---|
Protein Sequence Length: 216 aa Download sequence Send to blast |
MVRQKIQINK IDNLTARQVT FSKRRRGLFK KAQELSVLCD AEIALIVFSA TGKLFDFSSS 60 SMTQVIKRYT TQTENSNNLG QQSLLVDQAE GTRQDLLNKE LAKRKIELQQ LQGEELEGLS 120 LDDLMRLEKF VEGGLSRVGK FKDDKFLNEI SILKAKESEL MEENARLKHQ AKRYEGMRTA 180 VEVDPGNSAG SVSNSRSFAL SAEDKTDSDT SLRLCL |
3D Structure ? help Back to Top | ||||||
---|---|---|---|---|---|---|
PDB ID | Evalue | Query Start | Query End | Hit Start | Hit End | Description |
5f28_A | 3e-21 | 1 | 74 | 1 | 74 | MEF2C |
5f28_B | 3e-21 | 1 | 74 | 1 | 74 | MEF2C |
5f28_C | 3e-21 | 1 | 74 | 1 | 74 | MEF2C |
5f28_D | 3e-21 | 1 | 74 | 1 | 74 | MEF2C |
Search in ModeBase |
Functional Description ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Description | |||||
UniProt | Transcription repressor that inhibit floral transition in the autonomous flowering pathway, independent of photoperiod and temperature. Acts in a dosage-dependent manner. Together with AGL24 and AP1, controls the identity of the floral meristem and regulates expression of class B, C and E genes. Promotes EFM expression to suppress flowering (PubMed:25132385). {ECO:0000269|PubMed:16679456, ECO:0000269|PubMed:18694458, ECO:0000269|PubMed:19656343, ECO:0000269|PubMed:25132385}. |
Cis-element ? help Back to Top | |
---|---|
Source | Link |
PlantRegMap | KZV52255.1 |
Regulation -- Description ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Description | |||||
UniProt | INDUCTION: Repressed by the floral homeotic genes AP1 and SEP3 in emerging floral meristems. Up-regulated by HUA2. {ECO:0000269|PubMed:15659097, ECO:0000269|PubMed:17428825, ECO:0000269|PubMed:18694458}. |
Regulation -- PlantRegMap ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Upstream Regulator | Target Gene | ||||
PlantRegMap | Retrieve | - |
Annotation -- Protein ? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | ||||
Refseq | XP_011087945.1 | 3e-80 | MADS-box protein SVP isoform X1 | ||||
Refseq | XP_020551408.1 | 3e-80 | MADS-box protein SVP isoform X1 | ||||
Refseq | XP_020551409.1 | 3e-80 | MADS-box protein SVP isoform X1 | ||||
Swissprot | Q9FVC1 | 4e-61 | SVP_ARATH; MADS-box protein SVP | ||||
TrEMBL | A0A2Z7CZ95 | 1e-153 | A0A2Z7CZ95_9LAMI; MADS transcriptional factor | ||||
STRING | Migut.B00557.1.p | 1e-77 | (Erythranthe guttata) |
Orthologous Group ? help Back to Top | |||
---|---|---|---|
Lineage | Orthologous Group ID | Taxa Number | Gene Number |
Asterids | OGEA938 | 23 | 77 |
Best hit in Arabidopsis thaliana ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Hit ID | E-value | Description | ||||
AT2G22540.1 | 5e-55 | MIKC_MADS family protein |