PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID KZV52110.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Lamiales; Gesneriaceae; Didymocarpoideae; Trichosporeae; Loxocarpinae; Dorcoceras
Family MYB
Protein Properties Length: 890aa    MW: 98711.5 Da    PI: 7.5713
Description MYB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
KZV52110.1genomeCNUView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding58.12e-18155202148
                      TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
  Myb_DNA-binding   1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48 
                      +g+WTt Ed +lvd+v+++G g+W++I ++ g+ R++k+c++rw ++l
       KZV52110.1 155 KGPWTTAEDSILVDYVTKHGEGNWNAIQKHTGLARCGKSCRLRWANHL 202
                      79******************************************9986 PP

2Myb_DNA-binding49.21.2e-15208251146
                      TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHH CS
  Myb_DNA-binding   1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqk 46 
                      +g++T eE+ l++++++++G++ W++ a++++ gRt++++k++w++
       KZV52110.1 208 KGAFTLEEENLIIELHAKMGNK-WAKMAAELP-GRTDNEIKNYWNT 251
                      799*******************.*********.***********96 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5129417.479150202IPR017930Myb domain
SuperFamilySSF466893.59E-30152249IPR009057Homeodomain-like
SMARTSM007171.0E-13154204IPR001005SANT/Myb domain
PfamPF002491.8E-15155202IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.601.4E-23156209IPR009057Homeodomain-like
CDDcd001673.04E-11157202No hitNo description
PROSITE profilePS5129425.434203257IPR017930Myb domain
SMARTSM007172.0E-16207255IPR001005SANT/Myb domain
PfamPF002497.5E-15208251IPR001005SANT/Myb domain
CDDcd001671.08E-11210251No hitNo description
Gene3DG3DSA:1.10.10.606.9E-25210256IPR009057Homeodomain-like
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 890 aa     Download sequence    Send to blast
MSFVKANVIY DCYESIIFDD QNSPKLSDNG KADIGFSKPE NSKPRWLKNR LDKDKAKSGR  60
KPFVPNQPWR SSTKIKSGWK KVQQKRDLSG HKMKSKLNIP HNYAQTLKDT YTGKTVKVIS  120
MTSDSEDMMP MNGEDSPLED AIDGGNVSGN VSLKKGPWTT AEDSILVDYV TKHGEGNWNA  180
IQKHTGLARC GKSCRLRWAN HLRPDLKKGA FTLEEENLII ELHAKMGNKW AKMAAELPGR  240
TDNEIKNYWN TRVKRRQRAG LPIYPPDLHV QSFNENQPDD DSNSFSSMEA PHFDLLPYNN  300
LEIPEFKGFD LNQQFYSGDS KLAGDPYLTY PNESCFPSSH SPKHPERPEY FYHGSNPVVS  360
NVTPDFSQHH YDGYLPTAHS FQFSPAYDYS SNYYNGSSSS AFPGSHVILN GKPSSSEPAW  420
AMKLELPSLQ TEMGSWGSPS TPLPYLESVD TLIQTPPNEL CTPACSLSPG NSGLLDAVLY  480
ESQIMKISNT NSHQQTSLAS GLDDDIVDTS SQDPQTGWEP YVEPVSPLGH SSPAMFTEST  540
PSNGNSSQFI EVTPAAAPPR RKLRAAAART SPINTHSRAT ICACCASSIA RPVASSRKPS  600
SSSTPPCIEH RPPSNERRAT SGATLCNACE SGGRIARPTR PRHATSAAGA RPRSATSAAG  660
ARPRRATSFA THRQEKPSHA RPACMYLARS CARSKERSKD RRMRTRSDRR PNRKNDRKVL  720
VAEESTKSWV DTDSESSSSS SSSSDSEQEE VHCFMADQTS DDEVFDFSNV EFTREDLVSA  780
LNDMVKDDNS EGETSTQSQP AYDKFNKMSF VKANVIYDCF ESITFDDQNS PKLNDNGKAG  840
IGFSKPVLVC EKQRVERFIV TISHTDSLAH FSLNRDVNQV LSEQPWAGRV
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1a5j_A4e-301532565107B-MYB
Search in ModeBase
Cis-element ? help Back to Top
SourceLink
PlantRegMapKZV52110.1
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
TrEMBLA0A2Z7CYG10.0A0A2Z7CYG1_9LAMI; Transcription factor GAMYB-like
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
AsteridsOGEA20212358
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G11440.11e-76myb domain protein 65