PlantRegMap/PlantTFDB v5.0
Plant Transcription
Factor Database
|
Home TFext BLAST Prediction Download Help About Links PlantRegMap |
Transcription Factor Information
Basic Information? help Back to Top | |||||||||
---|---|---|---|---|---|---|---|---|---|
TF ID | KZV49755.1 | ||||||||
Organism | |||||||||
Taxonomic ID | |||||||||
Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Lamiales; Gesneriaceae; Didymocarpoideae; Trichosporeae; Loxocarpinae; Dorcoceras
|
||||||||
Family | MIKC_MADS | ||||||||
Protein Properties | Length: 206aa MW: 23549.5 Da PI: 8.2404 | ||||||||
Description | MIKC_MADS family protein | ||||||||
Gene Model |
|
Signature Domain? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
No. | Domain | Score | E-value | Start | End | HMM Start | HMM End |
1 | SRF-TF | 79.3 | 2.6e-25 | 9 | 58 | 1 | 50 |
S---SHHHHHHHHHHHHHHHHHHHHHHHHHHT-EEEEEEE-TTSEEEEEE CS SRF-TF 1 krienksnrqvtfskRrngilKKAeELSvLCdaevaviifsstgklyeys 50 k+ien++nrqvtfskRr g++KKA+E+ vLCd++ a+i+fss+g+l +s KZV49755.1 9 KKIENTTNRQVTFSKRRYGLIKKAYEIAVLCDIDLALIMFSSSGRLSHFS 58 68********************************************9997 PP | |||||||
2 | K-box | 14.2 | 1.8e-06 | 83 | 144 | 12 | 73 |
K-box 12 akaeslqqelakLkkeienLqreqRhllGedLesLslkeLqqLeqqLekslkkiRskKnell 73 ++ e+ q+e+ L++++e+ ++++R + e+ + s+ e q+ e +L ++l+++ ++K+ ll KZV49755.1 83 HNKEEIQKEIHDLRNQLESAEEQLRIFEPESEKFASMAEFQSCEVRLVEALRRVTQRKSFLL 144 57899*****************************************************8776 PP |
Protein Features ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Database | Entry ID | E-value | Start | End | InterPro ID | Description |
PROSITE profile | PS50066 | 28.413 | 1 | 61 | IPR002100 | Transcription factor, MADS-box |
SMART | SM00432 | 3.6E-33 | 1 | 60 | IPR002100 | Transcription factor, MADS-box |
CDD | cd00265 | 2.33E-32 | 2 | 78 | No hit | No description |
SuperFamily | SSF55455 | 5.89E-28 | 2 | 89 | IPR002100 | Transcription factor, MADS-box |
PRINTS | PR00404 | 1.2E-24 | 3 | 23 | IPR002100 | Transcription factor, MADS-box |
PROSITE pattern | PS00350 | 0 | 3 | 57 | IPR002100 | Transcription factor, MADS-box |
Pfam | PF00319 | 3.9E-23 | 10 | 57 | IPR002100 | Transcription factor, MADS-box |
PRINTS | PR00404 | 1.2E-24 | 23 | 38 | IPR002100 | Transcription factor, MADS-box |
PRINTS | PR00404 | 1.2E-24 | 38 | 59 | IPR002100 | Transcription factor, MADS-box |
Pfam | PF01486 | 2.3E-5 | 83 | 145 | IPR002487 | Transcription factor, K-box |
Gene Ontology ? help Back to Top | ||||||
---|---|---|---|---|---|---|
GO Term | GO Category | GO Description | ||||
GO:0006355 | Biological Process | regulation of transcription, DNA-templated | ||||
GO:0010152 | Biological Process | pollen maturation | ||||
GO:0080092 | Biological Process | regulation of pollen tube growth | ||||
GO:0005634 | Cellular Component | nucleus | ||||
GO:0003677 | Molecular Function | DNA binding | ||||
GO:0003700 | Molecular Function | transcription factor activity, sequence-specific DNA binding | ||||
GO:0046983 | Molecular Function | protein dimerization activity |
Sequence ? help Back to Top |
---|
Protein Sequence Length: 206 aa Download sequence Send to blast |
MGRSKLPIKK IENTTNRQVT FSKRRYGLIK KAYEIAVLCD IDLALIMFSS SGRLSHFSGR 60 KRIEDVIFRY LNLSDRDRGG TIHNKEEIQK EIHDLRNQLE SAEEQLRIFE PESEKFASMA 120 EFQSCEVRLV EALRRVTQRK SFLLSSFGVQ SSYHDTIQEI NTVVQYITEA QAQGGLDSHY 180 HEQGNGISQL NNINAGSDAS SVHLRV |
3D Structure ? help Back to Top | ||||||
---|---|---|---|---|---|---|
PDB ID | Evalue | Query Start | Query End | Hit Start | Hit End | Description |
6byy_A | 1e-17 | 1 | 75 | 1 | 74 | MEF2 CHIMERA |
6byy_B | 1e-17 | 1 | 75 | 1 | 74 | MEF2 CHIMERA |
6byy_C | 1e-17 | 1 | 75 | 1 | 74 | MEF2 CHIMERA |
6byy_D | 1e-17 | 1 | 75 | 1 | 74 | MEF2 CHIMERA |
6bz1_A | 1e-17 | 1 | 75 | 1 | 74 | MEF2 CHIMERA |
6bz1_B | 1e-17 | 1 | 75 | 1 | 74 | MEF2 CHIMERA |
6bz1_C | 1e-17 | 1 | 75 | 1 | 74 | MEF2 CHIMERA |
6bz1_D | 1e-17 | 1 | 75 | 1 | 74 | MEF2 CHIMERA |
Search in ModeBase |
Functional Description ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Description | |||||
UniProt | Probable transcription factor that forms a heterodimer with the MADS-box protein AGL30 and is involved in the regulation of pollen maturation at the late stages of pollen development and pollen tube growth. {ECO:0000269|PubMed:19211705}. |
Cis-element ? help Back to Top | |
---|---|
Source | Link |
PlantRegMap | KZV49755.1 |
Regulation -- PlantRegMap ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Upstream Regulator | Target Gene | ||||
PlantRegMap | Retrieve | - |
Annotation -- Protein ? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | ||||
Refseq | XP_011097601.1 | 1e-99 | agamous-like MADS-box protein AGL66 | ||||
Swissprot | Q1PFC2 | 8e-48 | AGL66_ARATH; Agamous-like MADS-box protein AGL66 | ||||
TrEMBL | A0A2Z7CTQ1 | 1e-149 | A0A2Z7CTQ1_9LAMI; Uncharacterized protein | ||||
STRING | ORGLA08G0167200.1 | 8e-62 | (Oryza glaberrima) |
Orthologous Group ? help Back to Top | |||
---|---|---|---|
Lineage | Orthologous Group ID | Taxa Number | Gene Number |
Asterids | OGEA13070 | 14 | 16 |
Best hit in Arabidopsis thaliana ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Hit ID | E-value | Description | ||||
AT1G77980.1 | 3e-50 | AGAMOUS-like 66 |
Publications ? help Back to Top | |||
---|---|---|---|
|