PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID KZV47340.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Lamiales; Gesneriaceae; Didymocarpoideae; Trichosporeae; Loxocarpinae; Dorcoceras
Family GRAS
Protein Properties Length: 726aa    MW: 79445.7 Da    PI: 5.7777
Description GRAS family protein
Gene Model
Gene Model ID Type Source Coding Sequence
KZV47340.1genomeCNUView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1GRAS3404e-1043667252374
        GRAS   2 velLlecAeavssgdlelaqalLarlselaspdgdpmqRlaayfteALaarlarsvselykalppsetseknsseelaalklfsevsPilkfshltaNq 100
                 +++L+++Ae v++g+  laq++Larl+++ sp ++p++R+a+y +eAL+  l+   ++  + l p ++s+ + + ++ a+k+fse+sP+++f+h+t+Nq
  KZV47340.1 366 IDQLYKAAELVQTGNPVLAQEILARLNHQFSPIDKPFHRAAFYCKEALQLLLQT--NNNLD-LCPATSSPFSLIFKIGAYKAFSEISPLVQFAHFTCNQ 461
                 689*************************************************98..33333.4455555677*************************** PP

        GRAS 101 aIleavegeervHiiDfdisqGlQWpaLlqaLasRpegppslRiTgvgspesgskeeleetgerLakfAeelgvpfefnvlvakrledleleeL.rvkp 198
                 a+lea++g +r+Hi+Dfdi++G+QW++L+q+La R+eg+psl+iT+++s++++++ el  t+e+L +fA+e+++ fef+v+  ++l++ + ++  +++ 
  KZV47340.1 462 ALLEAFDGFHRIHIVDFDIGYGGQWASLIQELALRNEGTPSLKITVLASASTHDQIELGLTRENLVQFASEVNLAFEFEVMSIESLNSGSWSQCwHMSD 560
                 ********************************************************************************9889999998888757788 PP

        GRAS 199 gEalaVnlvlqlhrlldesvsleserdevLklvkslsPkvvvvveqeadhnsesFlerflealeyysalfdsleaklpreseerikvErellgreivnv 297
                 gE++aVnl +   +l++ +vs++     vL++vk+lsP++vv v++ +d+++ sF++++++al+ ys l++sl+a    ++++++k+Er+l+++ i++v
  KZV47340.1 561 GEVVAVNLPVG--SLVNYQVSVPL----VLHFVKQLSPRIVVSVDRGCDRTDLSFANHMIHALQSYSNLLESLDAV-NMNADAMQKIERFLIHPGIEKV 652
                 ********995..45544666666....*********************************************776.5789****************** PP

        GRAS 298 vacegaerrerhetlekWrerleeaGFkpvplsekaakqaklllrkvksdgyrveeesgslvlgWkdrpLvsvSaWr 374
                 v+ + +      e+ ++Wr ++ ++G++pv++s+++++qa++ll+k++++g+ +e+++ slvl+W++++L+s+SaWr
  KZV47340.1 653 VMGRFRY----PEKTQHWRTMFLSSGLSPVAFSNFTESQAECLLKKTPVRGFLIEKRQSSLVLCWQRKELISASAWR 725
                 *987776....9****************************************************************8 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5098545.237339705IPR005202Transcription factor GRAS
PfamPF035141.4E-101366725IPR005202Transcription factor GRAS
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0007623Biological Processcircadian rhythm
GO:0048768Biological Processroot hair cell tip growth
GO:0051301Biological Processcell division
Sequence ? help Back to Top
Protein Sequence    Length: 726 aa     Download sequence    Send to blast
MKGMPLPFDF EGPGALDLEL VVERRGVCGT LSFDFFKKNC FLDSSFVEPT SVLDSARISS  60
RPTSSSTLSS SFCGGATSTD TAGVAAVSDT NPSPKWQQDS TTATSSNVGP VDSELLPVPT  120
SLETGIGNAE KCAMEDWESV LSEPLTVSPT QEQSILRMII GDAEDPGMGN LQYTGGGASS  180
AAAEFEFNAG NSNRSNAGNA VLPSNAPSNY KFAPGSKNLV HPSSISDNFG AVGPHHQATF  240
DSSAEMKPPI FSPQLLMNQH QIQQSQNPSF YLPLTFAQHQ EQNPFVAPQA KRLNTGTICG  300
GQISKGSYEN TGQQDLLINR QQAIPHQLQL LPQYPQHRPM GSGQKPKIGG GEEPGHCLQQ  360
QQQAIIDQLY KAAELVQTGN PVLAQEILAR LNHQFSPIDK PFHRAAFYCK EALQLLLQTN  420
NNLDLCPATS SPFSLIFKIG AYKAFSEISP LVQFAHFTCN QALLEAFDGF HRIHIVDFDI  480
GYGGQWASLI QELALRNEGT PSLKITVLAS ASTHDQIELG LTRENLVQFA SEVNLAFEFE  540
VMSIESLNSG SWSQCWHMSD GEVVAVNLPV GSLVNYQVSV PLVLHFVKQL SPRIVVSVDR  600
GCDRTDLSFA NHMIHALQSY SNLLESLDAV NMNADAMQKI ERFLIHPGIE KVVMGRFRYP  660
EKTQHWRTMF LSSGLSPVAF SNFTESQAEC LLKKTPVRGF LIEKRQSSLV LCWQRKELIS  720
ASAWRC
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
5hyz_A3e-3338072518375GRAS family transcription factor containing protein, expressed
Search in ModeBase
Functional Description ? help Back to Top
Source Description
UniProtProbable transcription factor involved in plant development. {ECO:0000250}.
Cis-element ? help Back to Top
SourceLink
PlantRegMapKZV47340.1
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_011090295.10.0scarecrow-like protein 6
SwissprotO813161e-137SCL6_ARATH; Scarecrow-like protein 6
TrEMBLA0A2Z7CJQ30.0A0A2Z7CJQ3_9LAMI; Scarecrow-like protein 22-like
STRINGPGSC0003DMT4000667990.0(Solanum tuberosum)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
AsteridsOGEA62532235
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G00150.11e-136GRAS family protein
Publications ? help Back to Top
  1. Bari A,Orazova S,Ivashchenko A
    miR156- and miR171-binding sites in the protein-coding sequences of several plant genes.
    Biomed Res Int, 2013. 2013: p. 307145
    [PMID:23936788]
  2. Xue XY, et al.
    Interaction between two timing microRNAs controls trichome distribution in Arabidopsis.
    PLoS Genet., 2014. 10(4): p. e1004266
    [PMID:24699192]