PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID KZV44455.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Lamiales; Gesneriaceae; Didymocarpoideae; Trichosporeae; Loxocarpinae; Dorcoceras
Family MYB
Protein Properties Length: 513aa    MW: 56682.5 Da    PI: 4.8104
Description MYB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
KZV44455.1genomeCNUView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding59.11e-183582148
                     TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
  Myb_DNA-binding  1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48
                     +g+WTt Ed +lvd+v+++G g+W++I ++ g+ R++k+c++rw ++l
       KZV44455.1 35 KGPWTTAEDSILVDYVTKHGEGNWNAIQKHTGLARCGKSCRLRWANHL 82
                     79******************************************9986 PP

2Myb_DNA-binding50.26e-1688131146
                      TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHH CS
  Myb_DNA-binding   1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqk 46 
                      +g++T eE+ l++++++++G++ W++ a++++ gRt++++k++w++
       KZV44455.1  88 KGAFTLEEENLIIELHAKMGNK-WAKMAAELP-GRTDNEIKNYWNT 131
                      799*******************.*********.***********96 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5129417.4793082IPR017930Myb domain
SuperFamilySSF466891.57E-3032129IPR009057Homeodomain-like
SMARTSM007171.0E-133484IPR001005SANT/Myb domain
PfamPF002499.0E-163582IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.606.6E-243689IPR009057Homeodomain-like
CDDcd001671.26E-113782No hitNo description
PROSITE profilePS5129425.43483137IPR017930Myb domain
SMARTSM007172.0E-1687135IPR001005SANT/Myb domain
PfamPF002493.8E-1588131IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.603.3E-2590136IPR009057Homeodomain-like
CDDcd001674.44E-1290131No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 513 aa     Download sequence    Send to blast
MTSDSEDMMP MNGEDSPLED AIDGGNVSGN VSLKKGPWTT AEDSILVDYV TKHGEGNWNA  60
IQKHTGLARC GKSCRLRWAN HLRPDLKKGA FTLEEENLII ELHAKMGNKW AKMAAELPGR  120
TDNEIKNYWN TRVKRRQRAG LPIYPPDLHV QSFNENQPDD DSNSFSSMEA PHFDLLPYNN  180
LEIPEFKGFD LNQQFYSGDS KLAGDPYLTY PNESCFPSSH SPKHPERPEY FYHGSNPVVS  240
NVTPDFSQHH YDGYLPTAHS FQFSPAYDYS SNYYNGSSSS AFPGSHVILN GKPSSSEPAW  300
AMKLELPSLQ TEMGSWGSPS TPLPYLESVD TLIQTPPNEL CTPACSLSPG NSGLLDAVLY  360
ESQIMKISNT NSHQQTSLAS GLDDDIVDTS SQDPQTGWEP YVEPVSPLGH SSPAMFTEST  420
PSNGNSSQFI EVTPDNKPLD FLKAGFLTCY KMLLVLIKYH VKIIPCLKHA TGMLLINDPS  480
ALGVLRMECK VLSCLLTVFL LAVVSDIEIL GNS
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1h8a_C2e-323013622127MYB TRANSFORMING PROTEIN
Search in ModeBase
Cis-element ? help Back to Top
SourceLink
PlantRegMapKZV44455.1
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_022887698.11e-161transcription factor GAMYB-like isoform X1
RefseqXP_022887699.11e-161transcription factor GAMYB-like isoform X1
RefseqXP_022887700.11e-161transcription factor GAMYB-like isoform X2
TrEMBLA0A2Z7CCP50.0A0A2Z7CCP5_9LAMI; Transcription factor GAMYB-like
STRINGXP_009596031.11e-143(Nicotiana tomentosiformis)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
AsteridsOGEA20212358
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G11440.13e-80myb domain protein 65