PlantRegMap/PlantTFDB v5.0
Plant Transcription
Factor Database
|
Home TFext BLAST Prediction Download Help About Links PlantRegMap |
Transcription Factor Information
Basic Information? help Back to Top | |||||||||
---|---|---|---|---|---|---|---|---|---|
TF ID | KZV39664.1 | ||||||||
Organism | |||||||||
Taxonomic ID | |||||||||
Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Lamiales; Gesneriaceae; Didymocarpoideae; Trichosporeae; Loxocarpinae; Dorcoceras
|
||||||||
Family | NAC | ||||||||
Protein Properties | Length: 61aa MW: 7243.91 Da PI: 5.7674 | ||||||||
Description | NAC family protein | ||||||||
Gene Model |
|
Signature Domain? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
No. | Domain | Score | E-value | Start | End | HMM Start | HMM End |
1 | NAM | 43.3 | 1.1e-13 | 12 | 58 | 54 | 101 |
NAM 54 eekewyfFskrdkkyatgkrknratksgyWkatgkdkevlskkgelvg 101 +e++wyfF++r++ky++++r+ r++ +gyWkat dk +++ ++ vg KZV39664.1 12 GENDWYFFTSRERKYTNESRPDRQAGNGYWKATVGDKMIYD-NHVIVG 58 678*************************************9.665555 PP |
Protein Features ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Database | Entry ID | E-value | Start | End | InterPro ID | Description |
PROSITE profile | PS51005 | 17.904 | 1 | 61 | IPR003441 | NAC domain |
SuperFamily | SSF101941 | 6.15E-15 | 10 | 59 | IPR003441 | NAC domain |
Gene Ontology ? help Back to Top | ||||||
---|---|---|---|---|---|---|
GO Term | GO Category | GO Description | ||||
GO:0006355 | Biological Process | regulation of transcription, DNA-templated | ||||
GO:0003677 | Molecular Function | DNA binding |
Sequence ? help Back to Top |
---|
Protein Sequence Length: 61 aa Download sequence Send to blast |
WIFTTASYKS LGENDWYFFT SRERKYTNES RPDRQAGNGY WKATVGDKMI YDNHVIVGQE 60 D |
Cis-element ? help Back to Top | |
---|---|
Source | Link |
PlantRegMap | KZV39664.1 |
Regulation -- PlantRegMap ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Upstream Regulator | Target Gene | ||||
PlantRegMap | Retrieve | - |
Annotation -- Protein ? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | ||||
Refseq | XP_006453417.1 | 2e-15 | NAC transcription factor 25 | ||||
TrEMBL | A0A2Z7BZ32 | 2e-38 | A0A2Z7BZ32_9LAMI; Uncharacterized protein (Fragment) | ||||
STRING | XP_006474630.1 | 4e-15 | (Citrus sinensis) | ||||
STRING | XP_006453410.1 | 4e-15 | (Citrus clementina) |
Orthologous Group ? help Back to Top | |||
---|---|---|---|
Lineage | Orthologous Group ID | Taxa Number | Gene Number |
Asterids | OGEA746 | 24 | 103 |
Best hit in Arabidopsis thaliana ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Hit ID | E-value | Description | ||||
AT1G77450.1 | 1e-14 | NAC domain containing protein 32 |