PlantRegMap/PlantTFDB v5.0
Plant Transcription
Factor Database
|
Home TFext BLAST Prediction Download Help About Links PlantRegMap |
Transcription Factor Information
Basic Information? help Back to Top | |||||||||
---|---|---|---|---|---|---|---|---|---|
TF ID | KZV39518.1 | ||||||||
Organism | |||||||||
Taxonomic ID | |||||||||
Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Lamiales; Gesneriaceae; Didymocarpoideae; Trichosporeae; Loxocarpinae; Dorcoceras
|
||||||||
Family | NAC | ||||||||
Protein Properties | Length: 94aa MW: 10755 Da PI: 4.6106 | ||||||||
Description | NAC family protein | ||||||||
Gene Model |
|
Signature Domain? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
No. | Domain | Score | E-value | Start | End | HMM Start | HMM End |
1 | NAM | 41.4 | 4.4e-13 | 28 | 72 | 2 | 48 |
NAM 2 ppGfrFhPtdeelvveyLkkkvegkkleleevikevdiykvePwdLp 48 p G+rF Pt+eel+ +yL+kk++++++e +i +v+ yk++Pw+L KZV39518.1 28 PLGMRFAPTEEELI-RYLRKKIKNEPFED-VCICSVNFYKYNPWELT 72 89************.9**********888.67**************7 PP |
Protein Features ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Database | Entry ID | E-value | Start | End | InterPro ID | Description |
SuperFamily | SSF101941 | 3.27E-13 | 24 | 82 | IPR003441 | NAC domain |
PROSITE profile | PS51005 | 11.854 | 27 | 94 | IPR003441 | NAC domain |
Pfam | PF02365 | 4.2E-5 | 28 | 69 | IPR003441 | NAC domain |
Gene Ontology ? help Back to Top | ||||||
---|---|---|---|---|---|---|
GO Term | GO Category | GO Description | ||||
GO:0006355 | Biological Process | regulation of transcription, DNA-templated | ||||
GO:0003677 | Molecular Function | DNA binding |
Sequence ? help Back to Top |
---|
Protein Sequence Length: 94 aa Download sequence Send to blast |
MEHNQQSPTP ANPNQEPGPN ENAVPKFPLG MRFAPTEEEL IRYLRKKIKN EPFEDVCICS 60 VNFYKYNPWE LTDVHCDGTI DGTNRVVAAN YVDT |
Cis-element ? help Back to Top | |
---|---|
Source | Link |
PlantRegMap | KZV39518.1 |
Regulation -- PlantRegMap ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Upstream Regulator | Target Gene | ||||
PlantRegMap | Retrieve | - |
Annotation -- Protein ? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | ||||
TrEMBL | A0A2Z7C0Z0 | 1e-64 | A0A2Z7C0Z0_9LAMI; Uncharacterized protein |
Best hit in Arabidopsis thaliana ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Hit ID | E-value | Description | ||||
AT2G02450.2 | 1e-09 | NAC domain containing protein 35 |