PlantRegMap/PlantTFDB v5.0
Plant Transcription
Factor Database
|
Home TFext BLAST Prediction Download Help About Links PlantRegMap |
Transcription Factor Information
Basic Information? help Back to Top | |||||||||
---|---|---|---|---|---|---|---|---|---|
TF ID | KZV33167.1 | ||||||||
Organism | |||||||||
Taxonomic ID | |||||||||
Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Lamiales; Gesneriaceae; Didymocarpoideae; Trichosporeae; Loxocarpinae; Dorcoceras
|
||||||||
Family | bZIP | ||||||||
Protein Properties | Length: 159aa MW: 17560.7 Da PI: 10.4699 | ||||||||
Description | bZIP family protein | ||||||||
Gene Model |
|
Signature Domain? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
No. | Domain | Score | E-value | Start | End | HMM Start | HMM End |
1 | bZIP_1 | 44.7 | 2.9e-14 | 89 | 132 | 5 | 48 |
CHHHCHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHH CS bZIP_1 5 krerrkqkNReAArrsRqRKkaeieeLeekvkeLeaeNkaLkke 48 ++ +r++kNRe+A rsR+RK+a++ eLe v+ L++eN +L+ + KZV33167.1 89 RKRIRLMKNRESAARSRARKQAYTYELELQVAHLSEENARLRRQ 132 6789*************************************954 PP |
Protein Features ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Database | Entry ID | E-value | Start | End | InterPro ID | Description |
Gene3D | G3DSA:1.20.5.170 | 1.4E-12 | 83 | 134 | No hit | No description |
SMART | SM00338 | 6.3E-8 | 85 | 157 | IPR004827 | Basic-leucine zipper domain |
PROSITE profile | PS50217 | 10.071 | 87 | 132 | IPR004827 | Basic-leucine zipper domain |
Pfam | PF00170 | 2.9E-11 | 88 | 132 | IPR004827 | Basic-leucine zipper domain |
SuperFamily | SSF57959 | 1.75E-10 | 88 | 134 | No hit | No description |
CDD | cd14707 | 4.47E-20 | 89 | 133 | No hit | No description |
PROSITE pattern | PS00036 | 0 | 93 | 107 | IPR004827 | Basic-leucine zipper domain |
Gene Ontology ? help Back to Top | ||||||
---|---|---|---|---|---|---|
GO Term | GO Category | GO Description | ||||
GO:0009911 | Biological Process | positive regulation of flower development | ||||
GO:0045893 | Biological Process | positive regulation of transcription, DNA-templated | ||||
GO:2000028 | Biological Process | regulation of photoperiodism, flowering | ||||
GO:0005634 | Cellular Component | nucleus | ||||
GO:0003700 | Molecular Function | transcription factor activity, sequence-specific DNA binding | ||||
GO:0043565 | Molecular Function | sequence-specific DNA binding | ||||
GO:0043621 | Molecular Function | protein self-association |
Sequence ? help Back to Top |
---|
Protein Sequence Length: 159 aa Download sequence Send to blast |
MDDVWKGLTL SSLNHRTIST GSSGISAAQP PISDLGFQDL LSGPGPLINQ IHRSVSDGQK 60 SCSSSDISKP QMKTRAASGS CSDENAVVRK RIRLMKNRES AARSRARKQA YTYELELQVA 120 HLSEENARLR RQQQDKQCDA GGDERPKKNK LHRTLTAPF |
Cis-element ? help Back to Top | |
---|---|
Source | Link |
PlantRegMap | KZV33167.1 |
Regulation -- PlantRegMap ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Upstream Regulator | Target Gene | ||||
PlantRegMap | Retrieve | - |
Annotation -- Protein ? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | ||||
Refseq | XP_024924135.1 | 2e-26 | bZIP transcription factor 27-like | ||||
TrEMBL | A0A2Z7BGK9 | 1e-114 | A0A2Z7BGK9_9LAMI; Protein FD-like | ||||
STRING | XP_009802843.1 | 2e-24 | (Nicotiana sylvestris) |
Orthologous Group ? help Back to Top | |||
---|---|---|---|
Lineage | Orthologous Group ID | Taxa Number | Gene Number |
Asterids | OGEA3572 | 22 | 39 |
Best hit in Arabidopsis thaliana ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Hit ID | E-value | Description | ||||
AT4G35900.1 | 1e-25 | bZIP family protein |