PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID KZV32850.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Lamiales; Gesneriaceae; Didymocarpoideae; Trichosporeae; Loxocarpinae; Dorcoceras
Family GRAS
Protein Properties Length: 658aa    MW: 72364 Da    PI: 6.3678
Description GRAS family protein
Gene Model
Gene Model ID Type Source Coding Sequence
KZV32850.1genomeCNUView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1GRAS317.92.2e-973006572374
        GRAS   2 velLlecAeavssgdlelaqalLarlselaspdgdpmqRlaayfteALaarlarsvselykalppsetseknsseelaalklfsevsPilkfshltaNq 100
                 +++L+e+Ae v++g++ laqa+Larl+++ s+  +p+qR+a yf eA+++ l++  + l +  +p + s    + ++ a+klfse+sP+ +f+++t+Nq
  KZV32850.1 300 IDQLYEAAELVETGNFVLAQAILARLNHQLSSLNKPFQRAALYFNEAMESVLHG--NDLTSEAAPLPFS---LIFRIGAYKLFSEISPLTQFTNFTCNQ 393
                 689**************************************************9..8899889999998...*************************** PP

        GRAS 101 aIleavegeervHiiDfdisqGlQWpaLlqaLasRpegppslRiTgvgspesgskeeleetgerLakfAeelgvpfefnvlvakrledleleeL....r 195
                 a+le +eg +r+Hi+Dfdi++G+QW++L+q+L+ R+eg+ sl+iT+++sp+++++ el  ++e+L  fA+e++++fef+vl   ++++l++++     +
  KZV32850.1 394 AVLEVLEGFNRIHIVDFDIGYGVQWASLMQELSFRSEGTLSLKITAIASPSTHDQLELCLVHENLYLFANEINIKFEFQVL---NIDSLNYSSWcipfD 489
                 ********************************************************************************9...555555544322449 PP

        GRAS 196 vkpgEalaVnlvlqlhrlldesvsleserdevLklvkslsPkvvvvveqeadhnsesFlerflealeyysalfdsleaklpreseerikvErellgrei 294
                 v+++Ea aVnl +  + ++  +++++s    vL++vk+lsPk+vv +++ +d+++ +++ ++++al+ ys l++sl+a    +s++ +k+E++l+++ i
  KZV32850.1 490 VSEKEAFAVNLPVGSFATF--KLPVPS----VLHFVKQLSPKIVVSMDRGCDRTDLPLAIHIIHALQSYSNLLESLNAI-NMKSDALHKIEKFLFQPGI 581
                 999**********999998..555555....*********************************************776.6799*************** PP

        GRAS 295 vnvvacegaerrerhetlekWrerleeaGFkpvplsekaakqaklllrkvksdgyrveeesgslvlgWkdrpLvsvSaWr 374
                 + +v+ + ++      +  +Wr+ ++++GF+pvp+s+++++qa++++++++ +gy+ve+++ +lvl W++++L svSaW+
  KZV32850.1 582 KRIVTGRFRS----PGKTLHWRSLFHSSGFTPVPFSSFTESQAQCVVKRTSLRGYQVEKRQLALVLSWQRKELASVSAWK 657
                 ****987777....99999************************************************************8 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5098542.779273637IPR005202Transcription factor GRAS
PfamPF035147.6E-95300657IPR005202Transcription factor GRAS
Sequence ? help Back to Top
Protein Sequence    Length: 658 aa     Download sequence    Send to blast
MEHFYHSLQT ISQWRQDSTT ATSSSAGAGS VLLLVQPHIE IGGGGGAAYA CAMDDWESVL  60
SEPLPASSGQ ELSMLHLIMG DVADHSVGGV NKVLQISGGL LPSDVESGSS FGAAEQASGG  120
DSVSQFGTSF MLPNPAFIHC LSFPNNSFTA EKIDTLASNS SPNFLSDIKP SNYHNTVSSS  180
ASNNLGAFFN AKVLVNQHVA HSTENRSFLL PAQQQEHIPL VPPRAKRYNL SQSTGGIPKG  240
WSLDTGQELF LGREQLPCQH PLVFPHNLHQ RPLAGMGVDP NQNTGRDELG QCDQQQQAII  300
DQLYEAAELV ETGNFVLAQA ILARLNHQLS SLNKPFQRAA LYFNEAMESV LHGNDLTSEA  360
APLPFSLIFR IGAYKLFSEI SPLTQFTNFT CNQAVLEVLE GFNRIHIVDF DIGYGVQWAS  420
LMQELSFRSE GTLSLKITAI ASPSTHDQLE LCLVHENLYL FANEINIKFE FQVLNIDSLN  480
YSSWCIPFDV SEKEAFAVNL PVGSFATFKL PVPSVLHFVK QLSPKIVVSM DRGCDRTDLP  540
LAIHIIHALQ SYSNLLESLN AINMKSDALH KIEKFLFQPG IKRIVTGRFR SPGKTLHWRS  600
LFHSSGFTPV PFSSFTESQA QCVVKRTSLR GYQVEKRQLA LVLSWQRKEL ASVSAWKC
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
5hyz_A2e-3231765721375GRAS family transcription factor containing protein, expressed
Search in ModeBase
Functional Description ? help Back to Top
Source Description
UniProtProbable transcription factor involved in plant development. {ECO:0000250}.
Cis-element ? help Back to Top
SourceLink
PlantRegMapKZV32850.1
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_011093313.10.0scarecrow-like protein 27
RefseqXP_011093314.10.0scarecrow-like protein 27
RefseqXP_022897183.10.0scarecrow-like protein 6
SwissprotO813161e-119SCL6_ARATH; Scarecrow-like protein 6
TrEMBLA0A2Z7BF340.0A0A2Z7BF34_9LAMI; Scarecrow-like protein 22-like
STRINGPGSC0003DMT4000667990.0(Solanum tuberosum)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
AsteridsOGEA62532235
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G00150.11e-120GRAS family protein
Publications ? help Back to Top
  1. Bari A,Orazova S,Ivashchenko A
    miR156- and miR171-binding sites in the protein-coding sequences of several plant genes.
    Biomed Res Int, 2013. 2013: p. 307145
    [PMID:23936788]
  2. Xue XY, et al.
    Interaction between two timing microRNAs controls trichome distribution in Arabidopsis.
    PLoS Genet., 2014. 10(4): p. e1004266
    [PMID:24699192]