PlantRegMap/PlantTFDB v5.0
Plant Transcription
Factor Database
|
Home TFext BLAST Prediction Download Help About Links PlantRegMap |
Transcription Factor Information
Basic Information? help Back to Top | |||||||||
---|---|---|---|---|---|---|---|---|---|
TF ID | KZV27222.1 | ||||||||
Organism | |||||||||
Taxonomic ID | |||||||||
Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Lamiales; Gesneriaceae; Didymocarpoideae; Trichosporeae; Loxocarpinae; Dorcoceras
|
||||||||
Family | NAC | ||||||||
Protein Properties | Length: 258aa MW: 29625.3 Da PI: 8.9593 | ||||||||
Description | NAC family protein | ||||||||
Gene Model |
|
Signature Domain? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
No. | Domain | Score | E-value | Start | End | HMM Start | HMM End |
1 | NAM | 170.9 | 4.1e-53 | 14 | 139 | 1 | 128 |
NAM 1 lppGfrFhPtdeelvveyLkkkvegkkleleevikevdiykvePwdLpkkvkaeekewyfFskrdkkyatgkrknratksgyWkatgkdkevlskkgel 99 lppGfrF Ptdeel+v+yL++kv+g +++l ++i e+d+yk++PwdLp+k+ +ekewyfFs+rd+ky++g+r+nr++ sgyWkatg+dk +++ +g++ KZV27222.1 14 LPPGFRFFPTDEELLVQYLCRKVAGLHFPL-QIIGEIDLYKFDPWDLPRKAVFGEKEWYFFSPRDRKYPNGSRPNRVAGSGYWKATGTDKIITT-EGRK 110 79****************************.89***************8777899***********************************9999.999* PP NAM 100 vglkktLvfykgrapkgektdWvmheyrl 128 vg+kk+Lvfy+g+apkg+ktdW+mheyrl KZV27222.1 111 VGIKKSLVFYEGKAPKGSKTDWIMHEYRL 139 ***************************98 PP |
Protein Features ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Database | Entry ID | E-value | Start | End | InterPro ID | Description |
SuperFamily | SSF101941 | 1.44E-67 | 7 | 163 | IPR003441 | NAC domain |
PROSITE profile | PS51005 | 61.097 | 14 | 162 | IPR003441 | NAC domain |
Pfam | PF02365 | 6.7E-26 | 15 | 139 | IPR003441 | NAC domain |
Gene Ontology ? help Back to Top | ||||||
---|---|---|---|---|---|---|
GO Term | GO Category | GO Description | ||||
GO:0009414 | Biological Process | response to water deprivation | ||||
GO:0009737 | Biological Process | response to abscisic acid | ||||
GO:0045893 | Biological Process | positive regulation of transcription, DNA-templated | ||||
GO:0005634 | Cellular Component | nucleus | ||||
GO:0003677 | Molecular Function | DNA binding | ||||
GO:0003700 | Molecular Function | transcription factor activity, sequence-specific DNA binding |
Sequence ? help Back to Top |
---|
Protein Sequence Length: 258 aa Download sequence Send to blast |
MVFSRSDTVS QMNLPPGFRF FPTDEELLVQ YLCRKVAGLH FPLQIIGEID LYKFDPWDLP 60 RKAVFGEKEW YFFSPRDRKY PNGSRPNRVA GSGYWKATGT DKIITTEGRK VGIKKSLVFY 120 EGKAPKGSKT DWIMHEYRLS EPSRKHGSSK LDDWVLCRIY KKNSSKQSQS SCEIESREYS 180 HGSSPSSSSH YDVVLESLEH IDDRFANLPR MDSLKLNLQN WGSGNFDWAT LAGLNSLPEY 240 VQAQQSQPYR DDVSSSKL |
3D Structure ? help Back to Top | ||||||
---|---|---|---|---|---|---|
PDB ID | Evalue | Query Start | Query End | Hit Start | Hit End | Description |
1ut4_A | 1e-100 | 1 | 167 | 4 | 170 | NO APICAL MERISTEM PROTEIN |
1ut4_B | 1e-100 | 1 | 167 | 4 | 170 | NO APICAL MERISTEM PROTEIN |
1ut7_A | 1e-100 | 1 | 167 | 4 | 170 | NO APICAL MERISTEM PROTEIN |
1ut7_B | 1e-100 | 1 | 167 | 4 | 170 | NO APICAL MERISTEM PROTEIN |
3swm_A | 1e-100 | 1 | 167 | 7 | 173 | NAC domain-containing protein 19 |
3swm_B | 1e-100 | 1 | 167 | 7 | 173 | NAC domain-containing protein 19 |
3swm_C | 1e-100 | 1 | 167 | 7 | 173 | NAC domain-containing protein 19 |
3swm_D | 1e-100 | 1 | 167 | 7 | 173 | NAC domain-containing protein 19 |
3swp_A | 1e-100 | 1 | 167 | 7 | 173 | NAC domain-containing protein 19 |
3swp_B | 1e-100 | 1 | 167 | 7 | 173 | NAC domain-containing protein 19 |
3swp_C | 1e-100 | 1 | 167 | 7 | 173 | NAC domain-containing protein 19 |
3swp_D | 1e-100 | 1 | 167 | 7 | 173 | NAC domain-containing protein 19 |
4dul_A | 1e-100 | 1 | 167 | 4 | 170 | NAC domain-containing protein 19 |
4dul_B | 1e-100 | 1 | 167 | 4 | 170 | NAC domain-containing protein 19 |
Search in ModeBase |
Functional Description ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Description | |||||
UniProt | Transcription factor that acts downstream of MYC2 in the jasmonate-mediated response to Botrytis cinerea infection (PubMed:28733419). With MYC2 forms a transcription module that regulates wounding-responsive genes (PubMed:28733419). Involved in jasmonate- and coronatine-mediated stomatal reopening in response to Pseudomonas syringae pv tomato DC3000 infection (PubMed:25005917). Regulates the expression of threonine deaminase 2 (TD2) through promoter binding (PubMed:28733419). {ECO:0000269|PubMed:25005917, ECO:0000269|PubMed:28733419}. |
Cis-element ? help Back to Top | |
---|---|
Source | Link |
PlantRegMap | KZV27222.1 |
Regulation -- Description ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Description | |||||
UniProt | INDUCTION: Induced by jasmonate (JA) (PubMed:25005917, PubMed:28733419, PubMed:30610166). Induced by wounding (PubMed:28733419, PubMed:25005917). Induced by infection with the fungal pathogen Botrytis cinerea (PubMed:28733419). Induced by coronatine (PubMed:25005917). {ECO:0000269|PubMed:25005917, ECO:0000269|PubMed:28733419, ECO:0000269|PubMed:30610166}. |
Regulation -- PlantRegMap ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Upstream Regulator | Target Gene | ||||
PlantRegMap | Retrieve | - |
Annotation -- Protein ? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | ||||
Refseq | XP_011095243.1 | 1e-136 | NAC domain-containing protein 72 | ||||
Swissprot | A0A3Q7HH64 | 1e-125 | JA2L_SOLLC; NAC domain-containing protein JA2L | ||||
TrEMBL | A0A2Z7B6S1 | 0.0 | A0A2Z7B6S1_9LAMI; NAC domain-containing protein 72-like | ||||
STRING | Migut.M00863.1.p | 1e-133 | (Erythranthe guttata) |
Orthologous Group ? help Back to Top | |||
---|---|---|---|
Lineage | Orthologous Group ID | Taxa Number | Gene Number |
Asterids | OGEA3122 | 24 | 52 |
Best hit in Arabidopsis thaliana ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Hit ID | E-value | Description | ||||
AT4G27410.2 | 1e-115 | NAC family protein |
Publications ? help Back to Top | |||
---|---|---|---|
|