PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID KZV25739.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Lamiales; Gesneriaceae; Didymocarpoideae; Trichosporeae; Loxocarpinae; Dorcoceras
Family MYB_related
Protein Properties Length: 299aa    MW: 33333.4 Da    PI: 8.2228
Description MYB_related family protein
Gene Model
Gene Model ID Type Source Coding Sequence
KZV25739.1genomeCNUView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding445e-14138182347
                      SS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHH CS
  Myb_DNA-binding   3 rWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqky 47 
                      +WT++E++l++ + k++G+g+W+ I+r +  +Rt+ q+ s+ qky
       KZV25739.1 138 PWTEDEHKLFLMGLKKYGKGDWRNISRNFVITRTPTQVASHAQKY 182
                      8*****************************99************9 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS512937.8172477IPR017884SANT domain
SMARTSM007176.1E-82577IPR001005SANT/Myb domain
SuperFamilySSF466897.18E-112882IPR009057Homeodomain-like
CDDcd001676.05E-72974No hitNo description
Gene3DG3DSA:1.10.10.602.9E-12129187IPR009057Homeodomain-like
PROSITE profilePS5129420.138131187IPR017930Myb domain
SuperFamilySSF466892.01E-16133186IPR009057Homeodomain-like
TIGRFAMsTIGR015571.8E-17134186IPR006447Myb domain, plants
SMARTSM007171.3E-12135185IPR001005SANT/Myb domain
CDDcd001676.66E-11138183No hitNo description
PfamPF002491.8E-12138182IPR001005SANT/Myb domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 299 aa     Download sequence    Send to blast
MKWGMEILSP SSCFSNSSLF LGESRATGWT QAENKAFENA LAMFDENTPD RWRRVAEMVP  60
GKTVGDVMRQ YKELEDDVSS IEAGLIPVPG YTTSLPFTLE WGGSHVYDGF NQSCHVSGGR  120
KSGSLVRSSD QERKKGVPWT EDEHKLFLMG LKKYGKGDWR NISRNFVITR TPTQVASHAQ  180
KYFIRQLSGG KDKRRASIHD ITTVTIGDNQ MLPPDDKKQP SPEFPNSASP MHELPLQWNQ  240
TNRDTIGGFN PGGILPYGAA SHGLKALGQN LSRNAAYESY LGSQNLIFQM QSELHYPNA
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
2cjj_A1e-152194176RADIALIS
Search in ModeBase
Functional Description ? help Back to Top
Source Description
UniProtInvolved in the dorsovental asymmetry of flowers. Promotes ventral identity. {ECO:0000269|PubMed:11937495, ECO:0000269|PubMed:9118809}.
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00568DAPTransfer from AT5G58900Download
Motif logo
Cis-element ? help Back to Top
SourceLink
PlantRegMapKZV25739.1
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieveRetrieve
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_011080854.11e-147transcription factor DIVARICATA isoform X1
RefseqXP_020550520.11e-147transcription factor DIVARICATA isoform X2
SwissprotQ8S9H71e-143DIV_ANTMA; Transcription factor DIVARICATA
TrEMBLA0A2Z7B2670.0A0A2Z7B267_9LAMI; Uncharacterized protein
STRINGGorai.009G093700.11e-133(Gossypium raimondii)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
AsteridsOGEA45824140
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G58900.11e-96Homeodomain-like transcriptional regulator
Publications ? help Back to Top
  1. Galego L,Almeida J
    Role of DIVARICATA in the control of dorsoventral asymmetry in Antirrhinum flowers.
    Genes Dev., 2002. 16(7): p. 880-91
    [PMID:11937495]
  2. Almeida J,Rocheta M,Galego L
    Genetic control of flower shape in Antirrhinum majus.
    Development, 1997. 124(7): p. 1387-92
    [PMID:9118809]