PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID KZV19540.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Lamiales; Gesneriaceae; Didymocarpoideae; Trichosporeae; Loxocarpinae; Dorcoceras
Family GRAS
Protein Properties Length: 546aa    MW: 59892.6 Da    PI: 4.504
Description GRAS family protein
Gene Model
Gene Model ID Type Source Coding Sequence
KZV19540.1genomeCNUView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1GRAS450.11.4e-1371825441374
        GRAS   1 lvelLlecAeavssgdlelaqalLarlselaspdgdpmqRlaayfteALaarlarsvselykalppsetseknsseelaalklfsevsPilkfshltaN 99 
                 lv+ L++cAeav++++l+la+al++++  la +++ +m+++a+yf+eALa+r+++        l ps+ +++  ++    +  f+e++P+lkf+h+taN
  KZV19540.1 182 LVHSLMACAEAVEQENLKLAEALVKNIGFLAISQAGAMRKVATYFAEALARRIYK--------LYPSNPQDSAFTDL--LQMHFYETCPYLKFAHFTAN 270
                 689***************************************************9........44444443334444..4446**************** PP

        GRAS 100 qaIleavegeervHiiDfdisqGlQWpaLlqaLasRpegppslRiTgvgspesgskeeleetgerLakfAeelgvpfefnvlvakrledleleeLrvkp 198
                 qaIlea++ge+rvH+iDf+++qG+QWpaLlqaLa Rp+gpp++R+Tgvg+p +++++ l+e+g+rLa++Ae+++v+fe++ +va++l+dl+ +++++++
  KZV19540.1 271 QAILEAFAGEDRVHVIDFSMKQGMQWPALLQALALRPGGPPTFRLTGVGPPPQDNTDHLQEVGWRLAQLAETINVEFEYKGFVASSLADLDSSMFDIRQ 369
                 *************************************************************************************************** PP

        GRAS 199 gEalaVnlvlqlhrlldesvsleserdevLklvkslsPkvvvvveqeadhnsesFlerflealeyysalfdsleak.lpr.eseerikvErellgreiv 295
                 gEa+aVn++++lh+ll++++++e+    vL++v+ + Pk+++vveqea+hn++ Fl+rf eal+yys+lfdsle+  +    s++++ +++++lg +i+
  KZV19540.1 370 GEAVAVNSIFELHQLLARPGAIEK----VLQVVRVMDPKIFTVVEQEANHNGPVFLDRFNEALNYYSTLFDSLESCgVDGvVSDQDKLMSEMYLGGQIC 464
                 ************************....*********************************************665143314599************** PP

        GRAS 296 nvvacegaerrerhetlekWrerleeaGFkpvplsekaakqaklllrkvk.sdgyrveeesgslvlgWkdrpLvsvSaWr 374
                 nvvaceg++r+erhetl+kW++rl+++GF+pv+l+++a+kqa +l++ ++ +dgyrvee++g+l+lgW++rpL+++SaWr
  KZV19540.1 465 NVVACEGSDRVERHETLAKWKNRLGSSGFEPVSLGSNAYKQAGMLVALFGgGDGYRVEESNGCLMLGWHTRPLIATSAWR 544
                 *******************************************************************************8 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM011291.4E-271792No hitNo description
PfamPF120411.5E-301786IPR021914Transcriptional factor DELLA, N-terminal
PROSITE profilePS5098566.213156523IPR005202Transcription factor GRAS
PfamPF035145.0E-135182544IPR005202Transcription factor GRAS
Sequence ? help Back to Top
Protein Sequence    Length: 546 aa     Download sequence    Send to blast
MLCSDSGKQK QSDSGFDELF AVLGYNVKSS DMASVAQKIE QLEEVMGSVE QEDGNVSHFA  60
SETIHYNPSD LSSWLESMIS GLNPLPELDL SPSAVILDPF LQPNQTAQAQ SDFGSELIAI  120
PGPAAYHYPR IQATPPPPAP GPSTPDRKLK SVPYSDAGEW NFPDESTRQV VLVDSQENGI  180
RLVHSLMACA EAVEQENLKL AEALVKNIGF LAISQAGAMR KVATYFAEAL ARRIYKLYPS  240
NPQDSAFTDL LQMHFYETCP YLKFAHFTAN QAILEAFAGE DRVHVIDFSM KQGMQWPALL  300
QALALRPGGP PTFRLTGVGP PPQDNTDHLQ EVGWRLAQLA ETINVEFEYK GFVASSLADL  360
DSSMFDIRQG EAVAVNSIFE LHQLLARPGA IEKVLQVVRV MDPKIFTVVE QEANHNGPVF  420
LDRFNEALNY YSTLFDSLES CGVDGVVSDQ DKLMSEMYLG GQICNVVACE GSDRVERHET  480
LAKWKNRLGS SGFEPVSLGS NAYKQAGMLV ALFGGGDGYR VEESNGCLML GWHTRPLIAT  540
SAWRPG
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
5b3h_A3e-6917754513379Protein SCARECROW
5b3h_D3e-6917754513379Protein SCARECROW
Search in ModeBase
Functional Description ? help Back to Top
Source Description
UniProtProbable transcriptional regulator that acts as a repressor of the gibberellin (GA) signaling pathway. Probably acts by participating in large multiprotein complexes that repress transcription of GA-inducible genes. Upon GA application, it is degraded by the proteasome, allowing the GA signaling pathway.
Cis-element ? help Back to Top
SourceLink
PlantRegMapKZV19540.1
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_011070609.10.0DELLA protein GAI1
SwissprotQ8S4W70.0GAI1_VITVI; DELLA protein GAI1
TrEMBLA0A2Z7ADU20.0A0A2Z7ADU2_9LAMI; Uncharacterized protein
STRINGMigut.E00445.1.p0.0(Erythranthe guttata)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
AsteridsOGEA21262462
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G01570.10.0GRAS family protein