PlantRegMap/PlantTFDB v5.0
Plant Transcription
Factor Database
|
Home TFext BLAST Prediction Download Help About Links PlantRegMap |
Transcription Factor Information
Basic Information? help Back to Top | |||||||||
---|---|---|---|---|---|---|---|---|---|
TF ID | KZV19466.1 | ||||||||
Organism | |||||||||
Taxonomic ID | |||||||||
Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Lamiales; Gesneriaceae; Didymocarpoideae; Trichosporeae; Loxocarpinae; Dorcoceras
|
||||||||
Family | MIKC_MADS | ||||||||
Protein Properties | Length: 148aa MW: 16694.5 Da PI: 9.5965 | ||||||||
Description | MIKC_MADS family protein | ||||||||
Gene Model |
|
Signature Domain? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
No. | Domain | Score | E-value | Start | End | HMM Start | HMM End |
1 | SRF-TF | 94.6 | 4.6e-30 | 9 | 59 | 1 | 51 |
S---SHHHHHHHHHHHHHHHHHHHHHHHHHHT-EEEEEEE-TTSEEEEEE- CS SRF-TF 1 krienksnrqvtfskRrngilKKAeELSvLCdaevaviifsstgklyeyss 51 krien s rqvtfskRr g+lKKA+ELSvLCdaeva+iifs++g+lye+ss KZV19466.1 9 KRIENASSRQVTFSKRRSGLLKKAFELSVLCDAEVALIIFSPSGRLYEFSS 59 79***********************************************96 PP | |||||||
2 | K-box | 44.5 | 6.8e-16 | 59 | 112 | 34 | 87 |
K-box 34 eqRhllGedLesLslkeLqqLeqqLekslkkiRskKnellleqieelqkkekel 87 + R+llGe+++s+s +eL +e+qLeksl+kiR++K+ l++ +l++k ++l KZV19466.1 59 SSRKLLGENIDSCSTEELALVEEQLEKSLSKIRARKEMKLMTLNTDLKEKYEML 112 57************************************************9987 PP |
Protein Features ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Database | Entry ID | E-value | Start | End | InterPro ID | Description |
PROSITE profile | PS50066 | 31.357 | 1 | 61 | IPR002100 | Transcription factor, MADS-box |
SMART | SM00432 | 5.8E-40 | 1 | 60 | IPR002100 | Transcription factor, MADS-box |
CDD | cd00265 | 2.60E-36 | 3 | 60 | No hit | No description |
PRINTS | PR00404 | 3.8E-30 | 3 | 23 | IPR002100 | Transcription factor, MADS-box |
SuperFamily | SSF55455 | 1.7E-28 | 3 | 64 | IPR002100 | Transcription factor, MADS-box |
PROSITE pattern | PS00350 | 0 | 3 | 57 | IPR002100 | Transcription factor, MADS-box |
Pfam | PF00319 | 4.4E-27 | 10 | 57 | IPR002100 | Transcription factor, MADS-box |
PRINTS | PR00404 | 3.8E-30 | 23 | 38 | IPR002100 | Transcription factor, MADS-box |
PROSITE profile | PS51297 | 7.164 | 37 | 123 | IPR002487 | Transcription factor, K-box |
PRINTS | PR00404 | 3.8E-30 | 38 | 59 | IPR002100 | Transcription factor, MADS-box |
Pfam | PF01486 | 2.2E-13 | 59 | 114 | IPR002487 | Transcription factor, K-box |
Gene Ontology ? help Back to Top | ||||||
---|---|---|---|---|---|---|
GO Term | GO Category | GO Description | ||||
GO:0006355 | Biological Process | regulation of transcription, DNA-templated | ||||
GO:0005634 | Cellular Component | nucleus | ||||
GO:0003677 | Molecular Function | DNA binding | ||||
GO:0003700 | Molecular Function | transcription factor activity, sequence-specific DNA binding | ||||
GO:0046983 | Molecular Function | protein dimerization activity |
Sequence ? help Back to Top |
---|
Protein Sequence Length: 148 aa Download sequence Send to blast |
MVRGKTQMKR IENASSRQVT FSKRRSGLLK KAFELSVLCD AEVALIIFSP SGRLYEFSSS 60 RKLLGENIDS CSTEELALVE EQLEKSLSKI RARKEMKLMT LNTDLKEKYE MLAVSSIPLC 120 QPLLPEIEVE TRLFIGPPTT TKATHVKS |
3D Structure ? help Back to Top | ||||||
---|---|---|---|---|---|---|
PDB ID | Evalue | Query Start | Query End | Hit Start | Hit End | Description |
1tqe_P | 2e-18 | 1 | 60 | 1 | 60 | Myocyte-specific enhancer factor 2B |
1tqe_Q | 2e-18 | 1 | 60 | 1 | 60 | Myocyte-specific enhancer factor 2B |
1tqe_R | 2e-18 | 1 | 60 | 1 | 60 | Myocyte-specific enhancer factor 2B |
1tqe_S | 2e-18 | 1 | 60 | 1 | 60 | Myocyte-specific enhancer factor 2B |
6byy_A | 2e-18 | 1 | 60 | 1 | 60 | MEF2 CHIMERA |
6byy_B | 2e-18 | 1 | 60 | 1 | 60 | MEF2 CHIMERA |
6byy_C | 2e-18 | 1 | 60 | 1 | 60 | MEF2 CHIMERA |
6byy_D | 2e-18 | 1 | 60 | 1 | 60 | MEF2 CHIMERA |
6bz1_A | 2e-18 | 1 | 60 | 1 | 60 | MEF2 CHIMERA |
6bz1_B | 2e-18 | 1 | 60 | 1 | 60 | MEF2 CHIMERA |
6bz1_C | 2e-18 | 1 | 60 | 1 | 60 | MEF2 CHIMERA |
6bz1_D | 2e-18 | 1 | 60 | 1 | 60 | MEF2 CHIMERA |
6c9l_A | 2e-18 | 1 | 60 | 1 | 60 | Myocyte-specific enhancer factor 2B |
6c9l_B | 2e-18 | 1 | 60 | 1 | 60 | Myocyte-specific enhancer factor 2B |
6c9l_C | 2e-18 | 1 | 60 | 1 | 60 | Myocyte-specific enhancer factor 2B |
6c9l_D | 2e-18 | 1 | 60 | 1 | 60 | Myocyte-specific enhancer factor 2B |
6c9l_E | 2e-18 | 1 | 60 | 1 | 60 | Myocyte-specific enhancer factor 2B |
6c9l_F | 2e-18 | 1 | 60 | 1 | 60 | Myocyte-specific enhancer factor 2B |
Search in ModeBase |
Functional Description ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Description | |||||
UniProt | Probable transcription factor that promotes flowering, especially in response to vernalization by short periods of cold, in an FLC-inpedendent manner. {ECO:0000269|PubMed:16778081}. |
Cis-element ? help Back to Top | |
---|---|
Source | Link |
PlantRegMap | KZV19466.1 |
Regulation -- Description ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Description | |||||
UniProt | INDUCTION: Maintained at very low levels by the polycomb-group (PcG) proteins MSI1, CLF, and EMF2 via histone methylation (H3K27me3). Derepressed upon cold treatment (vernalization). {ECO:0000269|PubMed:16778081}. |
Regulation -- PlantRegMap ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Upstream Regulator | Target Gene | ||||
PlantRegMap | Retrieve | - |
Annotation -- Protein ? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | ||||
Refseq | XP_011081162.1 | 8e-54 | MADS-box protein SOC1 | ||||
Swissprot | O82743 | 9e-48 | AGL19_ARATH; Agamous-like MADS-box protein AGL19 | ||||
TrEMBL | A0A2Z7ACU1 | 1e-101 | A0A2Z7ACU1_9LAMI; AGAMOUS-like 20 isoform 2 | ||||
STRING | Bra029424.1-P | 5e-49 | (Brassica rapa) |
Orthologous Group ? help Back to Top | |||
---|---|---|---|
Lineage | Orthologous Group ID | Taxa Number | Gene Number |
Asterids | OGEA40 | 24 | 625 |
Best hit in Arabidopsis thaliana ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Hit ID | E-value | Description | ||||
AT4G22950.1 | 4e-50 | AGAMOUS-like 19 |
Publications ? help Back to Top | |||
---|---|---|---|
|