PlantRegMap/PlantTFDB v5.0
Plant Transcription
Factor Database
|
Home TFext BLAST Prediction Download Help About Links PlantRegMap |
Transcription Factor Information
Basic Information? help Back to Top | |||||||||
---|---|---|---|---|---|---|---|---|---|
TF ID | KZV18852.1 | ||||||||
Organism | |||||||||
Taxonomic ID | |||||||||
Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Lamiales; Gesneriaceae; Didymocarpoideae; Trichosporeae; Loxocarpinae; Dorcoceras
|
||||||||
Family | MIKC_MADS | ||||||||
Protein Properties | Length: 224aa MW: 26140.8 Da PI: 9.8505 | ||||||||
Description | MIKC_MADS family protein | ||||||||
Gene Model |
|
Signature Domain? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
No. | Domain | Score | E-value | Start | End | HMM Start | HMM End |
1 | SRF-TF | 94.1 | 6.2e-30 | 9 | 59 | 1 | 51 |
S---SHHHHHHHHHHHHHHHHHHHHHHHHHHT-EEEEEEE-TTSEEEEEE- CS SRF-TF 1 krienksnrqvtfskRrngilKKAeELSvLCdaevaviifsstgklyeyss 51 krien++nrqvt+skRrng++KKA+EL vLCda+v++i++sst+kl+ey+s KZV18852.1 9 KRIENQTNRQVTYSKRRNGLFKKAHELTVLCDAKVSIIMISSTQKLHEYIS 59 79***********************************************86 PP | |||||||
2 | K-box | 91.2 | 1.8e-30 | 71 | 169 | 1 | 99 |
K-box 1 yqkssgksleeakaeslqqelakLkkeienLqreqRhllGedLesLslkeLqqLeqqLekslkkiRskKnellleqieelqkkekelqeenkaLrkkle 99 yqk+ g++l+++++e++q++l+kLk+ ++nL+re+R+++Ge+L++L++ ++ +L +++++sl+ iR++K++++ +qie+ +kk ++++e++++L +++ KZV18852.1 71 YQKAVGVDLWSSHYEKMQEHLKKLKEVNRNLRREIRQRMGESLNDLDYHQMVNLIEDMDNSLRIIRERKYKVIGNQIETGKKKLRNVEEIHRNLVLEFD 169 799999****************************************************************************************87765 PP |
Protein Features ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Database | Entry ID | E-value | Start | End | InterPro ID | Description |
SMART | SM00432 | 3.5E-39 | 1 | 60 | IPR002100 | Transcription factor, MADS-box |
PROSITE profile | PS50066 | 31.441 | 1 | 61 | IPR002100 | Transcription factor, MADS-box |
CDD | cd00265 | 8.89E-39 | 2 | 80 | No hit | No description |
PRINTS | PR00404 | 8.4E-28 | 3 | 23 | IPR002100 | Transcription factor, MADS-box |
SuperFamily | SSF55455 | 3.27E-36 | 3 | 96 | IPR002100 | Transcription factor, MADS-box |
PROSITE pattern | PS00350 | 0 | 3 | 57 | IPR002100 | Transcription factor, MADS-box |
Pfam | PF00319 | 2.3E-24 | 10 | 57 | IPR002100 | Transcription factor, MADS-box |
PRINTS | PR00404 | 8.4E-28 | 23 | 38 | IPR002100 | Transcription factor, MADS-box |
PRINTS | PR00404 | 8.4E-28 | 38 | 59 | IPR002100 | Transcription factor, MADS-box |
Pfam | PF01486 | 3.1E-17 | 82 | 166 | IPR002487 | Transcription factor, K-box |
PROSITE profile | PS51297 | 15.266 | 84 | 174 | IPR002487 | Transcription factor, K-box |
Gene Ontology ? help Back to Top | ||||||
---|---|---|---|---|---|---|
GO Term | GO Category | GO Description | ||||
GO:0006355 | Biological Process | regulation of transcription, DNA-templated | ||||
GO:0010093 | Biological Process | specification of floral organ identity | ||||
GO:0005634 | Cellular Component | nucleus | ||||
GO:0003677 | Molecular Function | DNA binding | ||||
GO:0003700 | Molecular Function | transcription factor activity, sequence-specific DNA binding | ||||
GO:0046983 | Molecular Function | protein dimerization activity |
Sequence ? help Back to Top |
---|
Protein Sequence Length: 224 aa Download sequence Send to blast |
MARGKIQIKR IENQTNRQVT YSKRRNGLFK KAHELTVLCD AKVSIIMISS TQKLHEYISP 60 SSTTKQLFDQ YQKAVGVDLW SSHYEKMQEH LKKLKEVNRN LRREIRQRMG ESLNDLDYHQ 120 MVNLIEDMDN SLRIIRERKY KVIGNQIETG KKKLRNVEEI HRNLVLEFDA RQEDPHYGLV 180 DNEGDYASVL GYPNRIISLR LPTNHHPSLH SGGGSDLTTF ALLE |
3D Structure ? help Back to Top | ||||||
---|---|---|---|---|---|---|
PDB ID | Evalue | Query Start | Query End | Hit Start | Hit End | Description |
5f28_A | 2e-16 | 1 | 59 | 1 | 59 | MEF2C |
5f28_B | 2e-16 | 1 | 59 | 1 | 59 | MEF2C |
5f28_C | 2e-16 | 1 | 59 | 1 | 59 | MEF2C |
5f28_D | 2e-16 | 1 | 59 | 1 | 59 | MEF2C |
Search in ModeBase |
Functional Description ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Description | |||||
UniProt | Transcription factor involved in the genetic control of flower development. Acts in conjunction with GLOBOSA (glo). |
Binding Motif ? help Back to Top | |||
---|---|---|---|
Motif ID | Method | Source | Motif file |
MP00077 | ChIP-seq | Transfer from AT3G54340 | Download |
Cis-element ? help Back to Top | |
---|---|
Source | Link |
PlantRegMap | KZV18852.1 |
Regulation -- PlantRegMap ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Upstream Regulator | Target Gene | ||||
PlantRegMap | Retrieve | Retrieve |
Annotation -- Protein ? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | ||||
Refseq | NP_001306615.1 | 1e-136 | floral homeotic protein DEFICIENS | ||||
Swissprot | P23706 | 1e-152 | DEFA_ANTMA; Floral homeotic protein DEFICIENS | ||||
TrEMBL | A0A2Z7AAZ3 | 1e-165 | A0A2Z7AAZ3_9LAMI; Uncharacterized protein | ||||
STRING | XP_009794650.1 | 1e-129 | (Nicotiana sylvestris) |
Orthologous Group ? help Back to Top | |||
---|---|---|---|
Lineage | Orthologous Group ID | Taxa Number | Gene Number |
Asterids | OGEA2314 | 24 | 51 |
Best hit in Arabidopsis thaliana ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Hit ID | E-value | Description | ||||
AT3G54340.1 | 1e-100 | MIKC_MADS family protein |
Publications ? help Back to Top | |||
---|---|---|---|
|