PlantRegMap/PlantTFDB v5.0
Plant Transcription
Factor Database
|
Home TFext BLAST Prediction Download Help About Links PlantRegMap |
Transcription Factor Information
Basic Information? help Back to Top | |||||||||
---|---|---|---|---|---|---|---|---|---|
TF ID | KZV17891.1 | ||||||||
Organism | |||||||||
Taxonomic ID | |||||||||
Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Lamiales; Gesneriaceae; Didymocarpoideae; Trichosporeae; Loxocarpinae; Dorcoceras
|
||||||||
Family | NAC | ||||||||
Protein Properties | Length: 92aa MW: 10480.8 Da PI: 4.2702 | ||||||||
Description | NAC family protein | ||||||||
Gene Model |
|
Signature Domain? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
No. | Domain | Score | E-value | Start | End | HMM Start | HMM End |
1 | NAM | 36.2 | 1.8e-11 | 28 | 73 | 2 | 49 |
NAM 2 ppGfrFhPtdeelvveyLkkkvegkkleleevikevdiykvePwdLpk 49 p+G+rF Pt+e l+ yL+kk+ ++++e +i +v+ yk++Pw+L KZV17891.1 28 PMGMRFVPTEEVLI-SYLRKKIMNEPFED-VCICSVNFYKYNPWELTV 73 89*******99999.9**********888.67**************63 PP |
Protein Features ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Database | Entry ID | E-value | Start | End | InterPro ID | Description |
SuperFamily | SSF101941 | 3.79E-11 | 24 | 73 | IPR003441 | NAC domain |
PROSITE profile | PS51005 | 10.792 | 27 | 92 | IPR003441 | NAC domain |
Pfam | PF02365 | 3.1E-4 | 28 | 75 | IPR003441 | NAC domain |
Gene Ontology ? help Back to Top | ||||||
---|---|---|---|---|---|---|
GO Term | GO Category | GO Description | ||||
GO:0006355 | Biological Process | regulation of transcription, DNA-templated | ||||
GO:0003677 | Molecular Function | DNA binding |
Sequence ? help Back to Top |
---|
Protein Sequence Length: 92 aa Download sequence Send to blast |
MERNQQSPTP ANPNQEPGPN ENAVPKFPMG MRFVPTEEVL ISYLRKKIMN EPFEDVCICS 60 VNFYKYNPWE LTVPSDGTNR PEDVVAASYV DT |
Cis-element ? help Back to Top | |
---|---|
Source | Link |
PlantRegMap | KZV17891.1 |
Regulation -- PlantRegMap ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Upstream Regulator | Target Gene | ||||
PlantRegMap | Retrieve | - |
Annotation -- Protein ? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | ||||
TrEMBL | A0A2Z7A865 | 2e-61 | A0A2Z7A865_9LAMI; Uncharacterized protein |
Best hit in Arabidopsis thaliana ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Hit ID | E-value | Description | ||||
AT3G10490.1 | 3e-09 | NAC domain containing protein 52 |