PlantRegMap/PlantTFDB v5.0
Plant Transcription
Factor Database
|
Home TFext BLAST Prediction Download Help About Links PlantRegMap |
Transcription Factor Information
Basic Information? help Back to Top | |||||||||
---|---|---|---|---|---|---|---|---|---|
TF ID | KZV06723.1 | ||||||||
Organism | |||||||||
Taxonomic ID | |||||||||
Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Lamiales; Gesneriaceae; Didymocarpoideae; Trichosporeae; Loxocarpinae; Dorcoceras
|
||||||||
Family | NF-YB | ||||||||
Protein Properties | Length: 104aa MW: 12130.1 Da PI: 7.9367 | ||||||||
Description | NF-YB family protein | ||||||||
Gene Model |
|
Signature Domain? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
No. | Domain | Score | E-value | Start | End | HMM Start | HMM End |
1 | NF-YB | 94.2 | 1.1e-29 | 1 | 63 | 35 | 97 |
NF-YB 35 vqecvsefisfvtseasdkcqrekrktingddllwalatlGfedyveplkvylkkyrelegek 97 +qecv+efisfvt+eas kc +ekrk +ngdd++wal tlGf++y+e+lk yl+k+re+e+e+ KZV06723.1 1 MQECVTEFISFVTGEASAKCFKEKRKIVNGDDICWALVTLGFDEYAEALKRYLRKHREAEEER 63 79*********************************************************9986 PP |
Protein Features ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Database | Entry ID | E-value | Start | End | InterPro ID | Description |
SuperFamily | SSF47113 | 9.92E-21 | 1 | 67 | IPR009072 | Histone-fold |
Pfam | PF00808 | 6.4E-11 | 1 | 37 | IPR003958 | Transcription factor CBF/NF-Y/archaeal histone domain |
Gene3D | G3DSA:1.10.20.10 | 3.7E-28 | 1 | 71 | IPR009072 | Histone-fold |
PRINTS | PR00615 | 6.9E-18 | 1 | 19 | No hit | No description |
PRINTS | PR00615 | 6.9E-18 | 20 | 38 | No hit | No description |
PRINTS | PR00615 | 6.9E-18 | 39 | 57 | No hit | No description |
Gene Ontology ? help Back to Top | ||||||
---|---|---|---|---|---|---|
GO Term | GO Category | GO Description | ||||
GO:0046982 | Molecular Function | protein heterodimerization activity |
Sequence ? help Back to Top |
---|
Protein Sequence Length: 104 aa Download sequence Send to blast |
MQECVTEFIS FVTGEASAKC FKEKRKIVNG DDICWALVTL GFDEYAEALK RYLRKHREAE 60 EERVNHNKVK DAPVLVNLGL NSMEKREYRN MGCQNIEKIM VMIK |
3D Structure ? help Back to Top | ||||||
---|---|---|---|---|---|---|
PDB ID | Evalue | Query Start | Query End | Hit Start | Hit End | Description |
4g91_B | 4e-23 | 1 | 58 | 35 | 92 | Transcription factor HapC (Eurofung) |
4g92_B | 4e-23 | 1 | 58 | 35 | 92 | Transcription factor HapC (Eurofung) |
Search in ModeBase |
Functional Description ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Description | |||||
UniProt | Component of the NF-Y/HAP transcription factor complex. The NF-Y complex stimulates the transcription of various genes by recognizing and binding to a CCAAT motif in promoters. |
Cis-element ? help Back to Top | |
---|---|
Source | Link |
PlantRegMap | KZV06723.1 |
Regulation -- PlantRegMap ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Upstream Regulator | Target Gene | ||||
PlantRegMap | Retrieve | - |
Annotation -- Protein ? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | ||||
Refseq | XP_011082631.1 | 3e-34 | nuclear transcription factor Y subunit B-5-like | ||||
Swissprot | O82248 | 7e-30 | NFYB5_ARATH; Nuclear transcription factor Y subunit B-5 | ||||
TrEMBL | A0A2Z7BEB6 | 5e-71 | A0A2Z7BEB6_9LAMI; Uncharacterized protein | ||||
STRING | XP_007144547.1 | 2e-33 | (Phaseolus vulgaris) |
Orthologous Group ? help Back to Top | |||
---|---|---|---|
Lineage | Orthologous Group ID | Taxa Number | Gene Number |
Asterids | OGEA111 | 24 | 356 |
Best hit in Arabidopsis thaliana ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Hit ID | E-value | Description | ||||
AT2G47810.1 | 3e-32 | nuclear factor Y, subunit B5 |
Publications ? help Back to Top | |||
---|---|---|---|
|