PlantRegMap/PlantTFDB v5.0
Plant Transcription
Factor Database
|
Home TFext BLAST Prediction Download Help About Links PlantRegMap |
Transcription Factor Information
Basic Information? help Back to Top | |||||||||
---|---|---|---|---|---|---|---|---|---|
TF ID | Dca58547.1 | ||||||||
Organism | |||||||||
Taxonomic ID | |||||||||
Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; Caryophyllales; Caryophyllaceae; Caryophylleae; Dianthus
|
||||||||
Family | MIKC_MADS | ||||||||
Protein Properties | Length: 251aa MW: 28318.4 Da PI: 8.8714 | ||||||||
Description | MIKC_MADS family protein | ||||||||
Gene Model |
|
Signature Domain? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
No. | Domain | Score | E-value | Start | End | HMM Start | HMM End |
1 | SRF-TF | 83.3 | 1.6e-26 | 9 | 59 | 1 | 51 |
S---SHHHHHHHHHHHHHHHHHHHHHHHHHHT-EEEEEEE-TTSEEEEEE- CS SRF-TF 1 krienksnrqvtfskRrngilKKAeELSvLCdaevaviifsstgklyeyss 51 k+ie+ rqvtfskRr g+lKKA+EL vLCdaevaviifs tg+l+++ss Dca58547.1 9 KKIEDANSRQVTFSKRRSGLLKKAHELAVLCDAEVAVIIFSATGRLFDFSS 59 68***********************************************96 PP | |||||||
2 | K-box | 60.3 | 7.8e-21 | 87 | 172 | 14 | 99 |
K-box 14 aeslqqelakLkkeienLqreqRhllGedLesLslkeLqqLeqqLekslkkiRskKnellleqieelqkkekelqeenkaLrkkle 99 +++ +e++ Lk+ei Lq q +l+G++L+ Lslk+LqqLe+qL ++l ++++kK++ll+eq+e ++ +e+++ en++Lr++++ Dca58547.1 87 ENEDMKEIDYLKNEITRLQLGQMRLQGKELSGLSLKDLQQLEKQLSEGLLSVKAKKDQLLMEQLELSRLQEQRALLENESLRRQVA 172 456678*****************************************************************************986 PP |
Protein Features ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Database | Entry ID | E-value | Start | End | InterPro ID | Description |
PROSITE profile | PS50066 | 32.099 | 1 | 61 | IPR002100 | Transcription factor, MADS-box |
SMART | SM00432 | 1.3E-40 | 1 | 60 | IPR002100 | Transcription factor, MADS-box |
CDD | cd00265 | 1.10E-42 | 2 | 77 | No hit | No description |
SuperFamily | SSF55455 | 2.49E-31 | 2 | 78 | IPR002100 | Transcription factor, MADS-box |
PRINTS | PR00404 | 3.5E-28 | 3 | 23 | IPR002100 | Transcription factor, MADS-box |
PROSITE pattern | PS00350 | 0 | 3 | 57 | IPR002100 | Transcription factor, MADS-box |
Pfam | PF00319 | 4.2E-25 | 10 | 57 | IPR002100 | Transcription factor, MADS-box |
PRINTS | PR00404 | 3.5E-28 | 23 | 38 | IPR002100 | Transcription factor, MADS-box |
PRINTS | PR00404 | 3.5E-28 | 38 | 59 | IPR002100 | Transcription factor, MADS-box |
PROSITE profile | PS51297 | 12.668 | 87 | 177 | IPR002487 | Transcription factor, K-box |
Pfam | PF01486 | 2.7E-15 | 90 | 171 | IPR002487 | Transcription factor, K-box |
Gene Ontology ? help Back to Top | ||||||
---|---|---|---|---|---|---|
GO Term | GO Category | GO Description | ||||
GO:0010047 | Biological Process | fruit dehiscence | ||||
GO:0010262 | Biological Process | somatic embryogenesis | ||||
GO:0045892 | Biological Process | negative regulation of transcription, DNA-templated | ||||
GO:0045893 | Biological Process | positive regulation of transcription, DNA-templated | ||||
GO:0048577 | Biological Process | negative regulation of short-day photoperiodism, flowering | ||||
GO:0060862 | Biological Process | negative regulation of floral organ abscission | ||||
GO:0060867 | Biological Process | fruit abscission | ||||
GO:0071365 | Biological Process | cellular response to auxin stimulus | ||||
GO:2000692 | Biological Process | negative regulation of seed maturation | ||||
GO:0005634 | Cellular Component | nucleus | ||||
GO:0005737 | Cellular Component | cytoplasm | ||||
GO:0003677 | Molecular Function | DNA binding | ||||
GO:0003700 | Molecular Function | transcription factor activity, sequence-specific DNA binding | ||||
GO:0042803 | Molecular Function | protein homodimerization activity |
Sequence ? help Back to Top |
---|
Protein Sequence Length: 251 aa Download sequence Send to blast |
MGRGKIEIKK IEDANSRQVT FSKRRSGLLK KAHELAVLCD AEVAVIIFSA TGRLFDFSSS 60 SMRRTLLRYQ NARESSEVVA GKPNMDENED MKEIDYLKNE ITRLQLGQMR LQGKELSGLS 120 LKDLQQLEKQ LSEGLLSVKA KKDQLLMEQL ELSRLQEQRA LLENESLRRQ VAKLQGCMTP 180 SEKSEQMYLE YYPIERKVSP QKLATFGADA ACSSEFEKTD SDVTLHLGPP CSKTRKRKVA 240 ESESASPTVS P |
3D Structure ? help Back to Top | ||||||
---|---|---|---|---|---|---|
PDB ID | Evalue | Query Start | Query End | Hit Start | Hit End | Description |
1tqe_P | 9e-24 | 1 | 92 | 1 | 89 | Myocyte-specific enhancer factor 2B |
1tqe_Q | 9e-24 | 1 | 92 | 1 | 89 | Myocyte-specific enhancer factor 2B |
1tqe_R | 9e-24 | 1 | 92 | 1 | 89 | Myocyte-specific enhancer factor 2B |
1tqe_S | 9e-24 | 1 | 92 | 1 | 89 | Myocyte-specific enhancer factor 2B |
6c9l_A | 9e-24 | 1 | 92 | 1 | 89 | Myocyte-specific enhancer factor 2B |
6c9l_B | 9e-24 | 1 | 92 | 1 | 89 | Myocyte-specific enhancer factor 2B |
6c9l_C | 9e-24 | 1 | 92 | 1 | 89 | Myocyte-specific enhancer factor 2B |
6c9l_D | 9e-24 | 1 | 92 | 1 | 89 | Myocyte-specific enhancer factor 2B |
6c9l_E | 9e-24 | 1 | 92 | 1 | 89 | Myocyte-specific enhancer factor 2B |
6c9l_F | 9e-24 | 1 | 92 | 1 | 89 | Myocyte-specific enhancer factor 2B |
Search in ModeBase |
Functional Description ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Description | |||||
UniProt | Probable transcription factor. |
Binding Motif ? help Back to Top | |||
---|---|---|---|
Motif ID | Method | Source | Motif file |
MP00508 | DAP | Transfer from AT5G13790 | Download |
Regulation -- PlantRegMap ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Upstream Regulator | Target Gene | ||||
PlantRegMap | Retrieve | Retrieve |
Annotation -- Protein ? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | ||||
Refseq | XP_021736404.1 | 1e-133 | agamous-like MADS-box protein AGL15 isoform X1 | ||||
Swissprot | Q39295 | 2e-73 | AGL15_BRANA; Agamous-like MADS-box protein AGL15 | ||||
TrEMBL | A0A0K9QY75 | 1e-127 | A0A0K9QY75_SPIOL; Uncharacterized protein | ||||
STRING | XP_010694750.1 | 1e-128 | (Beta vulgaris) |
Best hit in Arabidopsis thaliana ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Hit ID | E-value | Description | ||||
AT5G13790.1 | 3e-73 | AGAMOUS-like 15 |