PlantRegMap/PlantTFDB v5.0
Plant Transcription
Factor Database
|
Home TFext BLAST Prediction Download Help About Links PlantRegMap |
Transcription Factor Information
Basic Information? help Back to Top | |||||||||
---|---|---|---|---|---|---|---|---|---|
TF ID | Dca39010.1 | ||||||||
Organism | |||||||||
Taxonomic ID | |||||||||
Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; Caryophyllales; Caryophyllaceae; Caryophylleae; Dianthus
|
||||||||
Family | MYB | ||||||||
Protein Properties | Length: 199aa MW: 23014.8 Da PI: 6.367 | ||||||||
Description | MYB family protein | ||||||||
Gene Model |
|
Signature Domain? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
No. | Domain | Score | E-value | Start | End | HMM Start | HMM End |
1 | Myb_DNA-binding | 43.1 | 9.7e-14 | 4 | 50 | 2 | 44 |
SSS-HHHHHHHHHHHHHTTTT.....-HHHHHHHHTTTS-HHHHHHHH CS Myb_DNA-binding 2 grWTteEdellvdavkqlGgg.....tWktIartmgkgRtlkqcksrw 44 ++WT eEd+l+ +av ++ ++ W++Ia +++ gR+l+++++++ Dca39010.1 4 LKWTREEDKLFEEAVVLYSSEesedeKWRKIAGHVP-GRSLEELRDHY 50 69**********************************.**********9 PP | |||||||
2 | Myb_DNA-binding | 44.5 | 3.6e-14 | 99 | 143 | 3 | 47 |
SS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHH CS Myb_DNA-binding 3 rWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqky 47 +WT+eE+ l++ + ++G+g+W++I+r + +Rt+ q+ s+ qky Dca39010.1 99 PWTEEEHRLFLVGLDKYGKGDWRSISRNVVITRTPTQVASHAQKY 143 8*****************************99************9 PP |
Protein Features ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Database | Entry ID | E-value | Start | End | InterPro ID | Description |
PROSITE profile | PS51294 | 9.345 | 1 | 58 | IPR017930 | Myb domain |
SMART | SM00717 | 6.4E-9 | 2 | 56 | IPR001005 | SANT/Myb domain |
SuperFamily | SSF46689 | 1.51E-9 | 4 | 54 | IPR009057 | Homeodomain-like |
CDD | cd00167 | 2.28E-9 | 5 | 54 | No hit | No description |
Gene3D | G3DSA:1.10.10.60 | 1.4E-8 | 5 | 53 | IPR009057 | Homeodomain-like |
Pfam | PF00249 | 1.8E-10 | 5 | 50 | IPR001005 | SANT/Myb domain |
PROSITE profile | PS51294 | 19.434 | 92 | 148 | IPR017930 | Myb domain |
SuperFamily | SSF46689 | 3.18E-17 | 94 | 149 | IPR009057 | Homeodomain-like |
TIGRFAMs | TIGR01557 | 2.7E-17 | 95 | 147 | IPR006447 | Myb domain, plants |
SMART | SM00717 | 1.2E-11 | 96 | 146 | IPR001005 | SANT/Myb domain |
Gene3D | G3DSA:1.10.10.60 | 2.2E-11 | 98 | 142 | IPR009057 | Homeodomain-like |
CDD | cd00167 | 5.54E-10 | 99 | 144 | No hit | No description |
Pfam | PF00249 | 6.1E-13 | 99 | 143 | IPR001005 | SANT/Myb domain |
Gene Ontology ? help Back to Top | ||||||
---|---|---|---|---|---|---|
GO Term | GO Category | GO Description | ||||
GO:0003677 | Molecular Function | DNA binding |
Sequence ? help Back to Top |
---|
Protein Sequence Length: 199 aa Download sequence Send to blast |
MGGLKWTREE DKLFEEAVVL YSSEESEDEK WRKIAGHVPG RSLEELRDHY DELVYDVELI 60 DSGRVDPPSY SDELVTRCGQ INFEKKPPTC DLERKRGTPW TEEEHRLFLV GLDKYGKGDW 120 RSISRNVVIT RTPTQVASHA QKYFLRQNSV KKERKRTSIH DITTVQQTCI SPPQRPTLQQ 180 VGASQQGQAM GFQNFEYPA |
Functional Description ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Description | |||||
UniProt | Transcription activator that coordinates abscisic acid (ABA) biosynthesis and signaling-related genes via binding to the specific promoter motif 5'-(A/T)AACCAT-3'. Represses ABA-mediated salt (e.g. NaCl and KCl) stress tolerance. Regulates leaf shape and promotes vegetative growth. {ECO:0000269|PubMed:26243618}. |
Binding Motif ? help Back to Top | |||
---|---|---|---|
Motif ID | Method | Source | Motif file |
MP00055 | PBM | Transfer from AT5G04760 | Download |
Regulation -- Description ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Description | |||||
UniProt | INDUCTION: Induced by salicylic acid (SA) and gibberellic acid (GA) (PubMed:16463103). Triggered by dehydration and salt stress (PubMed:26243618). {ECO:0000269|PubMed:16463103, ECO:0000269|PubMed:26243618}. |
Regulation -- PlantRegMap ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Upstream Regulator | Target Gene | ||||
PlantRegMap | Retrieve | Retrieve |
Annotation -- Protein ? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | ||||
Refseq | XP_010695074.1 | 1e-85 | PREDICTED: transcription factor DIVARICATA | ||||
Swissprot | Q9FNN6 | 3e-58 | SRM1_ARATH; Transcription factor SRM1 | ||||
TrEMBL | A0A0J8E475 | 7e-84 | A0A0J8E475_BETVU; Uncharacterized protein | ||||
STRING | XP_010695074.1 | 4e-85 | (Beta vulgaris) |
Best hit in Arabidopsis thaliana ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Hit ID | E-value | Description | ||||
AT5G04760.1 | 2e-67 | MYB family protein |
Publications ? help Back to Top | |||
---|---|---|---|
|