PlantRegMap/PlantTFDB v5.0
Plant Transcription
Factor Database
|
Home TFext BLAST Prediction Download Help About Links PlantRegMap |
Transcription Factor Information
Basic Information? help Back to Top | |||||||||
---|---|---|---|---|---|---|---|---|---|
TF ID | Dca32697.1 | ||||||||
Organism | |||||||||
Taxonomic ID | |||||||||
Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; Caryophyllales; Caryophyllaceae; Caryophylleae; Dianthus
|
||||||||
Family | G2-like | ||||||||
Protein Properties | Length: 136aa MW: 15531.6 Da PI: 5.0301 | ||||||||
Description | G2-like family protein | ||||||||
Gene Model |
|
Signature Domain? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
No. | Domain | Score | E-value | Start | End | HMM Start | HMM End |
1 | G2-like | 88.6 | 5.7e-28 | 31 | 84 | 2 | 55 |
G2-like 2 prlrWtpeLHerFveaveqLGGsekAtPktilelmkvkgLtlehvkSHLQkYRl 55 +r+rWt+eLHe+F +av+qLGG e+AtP +l++m+v+gLt++hv+ HL kYR+ Dca32697.1 31 QRMRWTQELHEAFADAVSQLGGRERATPEDVLRVMNVEGLTIYHVRRHLLKYRI 84 8****************************************************7 PP |
Protein Features ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Database | Entry ID | E-value | Start | End | InterPro ID | Description |
PROSITE profile | PS51294 | 10.383 | 27 | 87 | IPR017930 | Myb domain |
Gene3D | G3DSA:1.10.10.60 | 8.6E-25 | 29 | 85 | IPR009057 | Homeodomain-like |
SuperFamily | SSF46689 | 1.68E-13 | 29 | 84 | IPR009057 | Homeodomain-like |
TIGRFAMs | TIGR01557 | 4.1E-19 | 31 | 84 | IPR006447 | Myb domain, plants |
Pfam | PF00249 | 1.6E-9 | 32 | 83 | IPR001005 | SANT/Myb domain |
Pfam | PF14379 | 2.0E-6 | 117 | 136 | IPR025756 | MYB-CC type transcription factor, LHEQLE-containing domain |
Gene Ontology ? help Back to Top | ||||||
---|---|---|---|---|---|---|
GO Term | GO Category | GO Description | ||||
GO:0003677 | Molecular Function | DNA binding |
Sequence ? help Back to Top |
---|
Protein Sequence Length: 136 aa Download sequence Send to blast |
EPLSLAELVV PRLEIQEQLS LLSTAEVSTT QRMRWTQELH EAFADAVSQL GGRERATPED 60 VLRVMNVEGL TIYHVRRHLL KYRIASIRPE LSEGNADDEM TDSAQESPVD LKTNITTTKA 120 LRMQIKLQKQ LHEQLE |
3D Structure ? help Back to Top | ||||||
---|---|---|---|---|---|---|
PDB ID | Evalue | Query Start | Query End | Hit Start | Hit End | Description |
6j4k_A | 8e-24 | 32 | 88 | 4 | 60 | Protein PHOSPHATE STARVATION RESPONSE 1 |
6j4k_B | 8e-24 | 32 | 88 | 4 | 60 | Protein PHOSPHATE STARVATION RESPONSE 1 |
6j5b_A | 8e-24 | 32 | 88 | 4 | 60 | Protein PHOSPHATE STARVATION RESPONSE 1 |
6j5b_C | 8e-24 | 32 | 88 | 4 | 60 | Protein PHOSPHATE STARVATION RESPONSE 1 |
6j5b_D | 8e-24 | 32 | 88 | 4 | 60 | Protein PHOSPHATE STARVATION RESPONSE 1 |
6j5b_F | 8e-24 | 32 | 88 | 4 | 60 | Protein PHOSPHATE STARVATION RESPONSE 1 |
6j5b_H | 8e-24 | 32 | 88 | 4 | 60 | Protein PHOSPHATE STARVATION RESPONSE 1 |
6j5b_J | 8e-24 | 32 | 88 | 4 | 60 | Protein PHOSPHATE STARVATION RESPONSE 1 |
Search in ModeBase |
Functional Description ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Description | |||||
UniProt | Transcription factor involved in phosphate starvation signaling (PubMed:11511543, PubMed:17927693, PubMed:26586833). Binds as a dimer to P1BS, an imperfect palindromic sequence 5'-GNATATNC-3', to promote the expression of inorganic phosphate (Pi) starvation-responsive genes (PubMed:11511543, PubMed:20838596, PubMed:26586833). SPX1 is a competitive inhibitor of this DNA-binding (PubMed:25271326). PHR1 binding to its targets is low Pi-dependent (PubMed:25271326). Regulates the expression of miR399 (PubMed:20838596). Regulates the expression of IPS1 (At3g09922), a non-coding RNA that mimics the target of miR399 to block the cleavage of PHO2 under Pi-deficient conditions (PubMed:17643101). Regulates lipid remodeling and triacylglycerol accumulation during phosphorus starvation (PubMed:25680792). Required for the shoot-specific hypoxic response (PubMed:24753539). Regulates FER1 expression upon phosphate starvation, linking iron and phosphate homeostasis (PubMed:23788639). Contributes to the homeostasis of both sulfate and phosphate in plants under phosphate deficiency (PubMed:21261953). Required for adaptation to high light and retaining functional photosynthesis during phosphate starvation (PubMed:21910737). Involved in the coregulation of Zn and Pi homeostasis (PubMed:24420568). {ECO:0000269|PubMed:11511543, ECO:0000269|PubMed:17643101, ECO:0000269|PubMed:17927693, ECO:0000269|PubMed:20838596, ECO:0000269|PubMed:21261953, ECO:0000269|PubMed:21910737, ECO:0000269|PubMed:23788639, ECO:0000269|PubMed:24420568, ECO:0000269|PubMed:24753539, ECO:0000269|PubMed:25271326, ECO:0000269|PubMed:25680792, ECO:0000269|PubMed:26586833}. |
Regulation -- Description ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Description | |||||
UniProt | INDUCTION: Only moderately up-regulated by Pi starvation. {ECO:0000269|PubMed:11511543}. |
Annotation -- Protein ? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | ||||
Refseq | XP_010675144.1 | 9e-45 | PREDICTED: myb family transcription factor PHL13 | ||||
Swissprot | Q94CL7 | 2e-35 | PHR1_ARATH; Protein PHOSPHATE STARVATION RESPONSE 1 | ||||
TrEMBL | Q9M620 | 3e-41 | Q9M620_MESCR; CDPK substrate protein 1 | ||||
STRING | XP_010675144.1 | 3e-44 | (Beta vulgaris) |
Best hit in Arabidopsis thaliana ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Hit ID | E-value | Description | ||||
AT4G28610.1 | 7e-38 | phosphate starvation response 1 |