PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Dca26557.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; Caryophyllales; Caryophyllaceae; Caryophylleae; Dianthus
Family STAT
Protein Properties Length: 558aa    MW: 62230.5 Da    PI: 5.134
Description STAT family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Dca26557.1genomeDCAView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1STAT172.95.1e-54691901122
        STAT   1 ldvvllnalgqpvekdvevvasLlyadsglvveksddaeapLLisydGvefssedrplkllrGrasfklkisqLsskcdnrLfrikfeipklkkypfle 99 
                 ldvvll+a+gqp++k+++vvasL+yad+ ++vek++d+eapLL+ +dG+efss d+p+++ +Gras+kl isqLsskc nrLf+ikfe++++++ypf e
  Dca26557.1  69 LDVVLLDAFGQPAHKELKVVASLIYADDRSPVEKAEDDEAPLLTICDGLEFSSIDKPSRFSQGRASLKLSISQLSSKCGNRLFCIKFEVLEMENYPFCE 167
                 8************************************************************************************************** PP

        STAT 100 avskpirCisrsrntrsssltkk 122
                 a++ pirCisr+ n ++++ t+k
  Dca26557.1 168 AFTPPIRCISRTGNGNMATITWK 190
                 ************99999988886 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:3.30.505.108.4E-4457496IPR000980SH2 domain
SuperFamilySSF555501.28E-5460514IPR000980SH2 domain
PROSITE profilePS500019.114463523IPR000980SH2 domain
Sequence ? help Back to Top
Protein Sequence    Length: 558 aa     Download sequence    Send to blast
MQKEGHNLDG YAYGAEVLRS TASIINHFLK DPPLQLCIDS ASASEVEVED DGIWNIVGGK  60
VSCRKLFSLD VVLLDAFGQP AHKELKVVAS LIYADDRSPV EKAEDDEAPL LTICDGLEFS  120
SIDKPSRFSQ GRASLKLSIS QLSSKCGNRL FCIKFEVLEM ENYPFCEAFT PPIRCISRTG  180
NGNMATITWK KLPSGVHLFN GSTVPQPGVG HSEPQQKTVC EPRMNPPLKR VKFGELAPME  240
DINADTSVKQ REEECNSYIM PEKEAASATG TSLASIQENY GSMDNSTSDS ESADARNSES  300
KNVPCNIDLL SDLTIFRYCL GSSSERSAML KEISVAFPEL DISDMAEKVA IFSGCTHQRH  360
QITISKRLLE EGAKTWNMIS RGSHRVQWDD IVFDIEEQFM RIACCSTRSL TQQDLNFLRR  420
VSGANDYMTK ENFHKMWCWL YPVAFTVSRP EINALWASTS PKWIEGFVTK EEVEFSLQST  480
SGISEPGTFI IRFPTTRSWP HPDAGSLVAS YVATDFSLRH RQLSLDYSSG MFEPNRKPLK  540
ELLLSEPGLS RLGRVAMD
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_010694737.10.0PREDICTED: uncharacterized protein LOC104907497
RefseqXP_010694738.10.0PREDICTED: uncharacterized protein LOC104907497
RefseqXP_010694739.10.0PREDICTED: uncharacterized protein LOC104907497
TrEMBLA0A0J8BB720.0A0A0J8BB72_BETVU; Uncharacterized protein
STRINGXP_010694737.10.0(Beta vulgaris)
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G78540.11e-147SH2 domain protein B