PlantRegMap/PlantTFDB v5.0
Plant Transcription
Factor Database
|
Home TFext BLAST Prediction Download Help About Links PlantRegMap |
Transcription Factor Information
Basic Information? help Back to Top | |||||||||
---|---|---|---|---|---|---|---|---|---|
TF ID | Dca21838.1 | ||||||||
Organism | |||||||||
Taxonomic ID | |||||||||
Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; Caryophyllales; Caryophyllaceae; Caryophylleae; Dianthus
|
||||||||
Family | MYB | ||||||||
Protein Properties | Length: 183aa MW: 21351.5 Da PI: 9.7709 | ||||||||
Description | MYB family protein | ||||||||
Gene Model |
|
Signature Domain? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
No. | Domain | Score | E-value | Start | End | HMM Start | HMM End |
1 | Myb_DNA-binding | 46 | 1.2e-14 | 8 | 53 | 2 | 48 |
SSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS Myb_DNA-binding 2 grWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48 g WT Ede+l+ av ++G ++W +I++ + ++++kqck rw+ +l Dca21838.1 8 GVWTNTEDEILKSAVSKYGENQWPRISSLLV-RKSPKQCKARWYEWL 53 78*****************************.************986 PP | |||||||
2 | Myb_DNA-binding | 28.5 | 3.4e-09 | 61 | 103 | 3 | 48 |
SS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS Myb_DNA-binding 3 rWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48 W e+de+l+++ k++++ W+tIa +g Rt+ qc +r+ k+l Dca21838.1 61 EWRREDDERLLHLAKLMPTQ-WRTIAPIVG--RTPSQCLERYEKLL 103 699***************99.********8..**********9986 PP |
Protein Features ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Database | Entry ID | E-value | Start | End | InterPro ID | Description |
PROSITE profile | PS51294 | 22.912 | 2 | 57 | IPR017930 | Myb domain |
Gene3D | G3DSA:1.10.10.60 | 1.1E-17 | 5 | 55 | IPR009057 | Homeodomain-like |
SMART | SM00717 | 1.1E-15 | 6 | 55 | IPR001005 | SANT/Myb domain |
Pfam | PF13921 | 4.6E-14 | 10 | 70 | No hit | No description |
CDD | cd00167 | 1.21E-12 | 10 | 53 | No hit | No description |
SuperFamily | SSF46689 | 1.38E-19 | 33 | 112 | IPR009057 | Homeodomain-like |
CDD | cd11659 | 7.80E-29 | 55 | 107 | No hit | No description |
Gene3D | G3DSA:1.10.10.60 | 7.0E-12 | 56 | 104 | IPR009057 | Homeodomain-like |
SMART | SM00717 | 2.8E-8 | 58 | 105 | IPR001005 | SANT/Myb domain |
PROSITE profile | PS51294 | 12.369 | 58 | 107 | IPR017930 | Myb domain |
Gene Ontology ? help Back to Top | ||||||
---|---|---|---|---|---|---|
GO Term | GO Category | GO Description | ||||
GO:0003677 | Molecular Function | DNA binding |
Sequence ? help Back to Top |
---|
Protein Sequence Length: 183 aa Download sequence Send to blast |
MRITIKGGVW TNTEDEILKS AVSKYGENQW PRISSLLVRK SPKQCKARWY EWLHPSINKI 60 EWRREDDERL LHLAKLMPTQ WRTIAPIVGR TPSQCLERYE KLLDLAVNAV SSSKQGDDPR 120 KLRPAEIDPK PESKPARPDP VDMDDEDEKE VLAFLQKKRE LKATGIIDAR RRGIDYNAYK 180 HIH |
3D Structure ? help Back to Top | ||||||
---|---|---|---|---|---|---|
PDB ID | Evalue | Query Start | Query End | Hit Start | Hit End | Description |
5mqf_L | 2e-76 | 2 | 178 | 3 | 212 | Cell division cycle 5-like protein |
5xjc_L | 2e-76 | 2 | 178 | 3 | 212 | Cell division cycle 5-like protein |
5yzg_L | 2e-76 | 2 | 178 | 3 | 212 | Cell division cycle 5-like protein |
5z56_L | 2e-76 | 2 | 178 | 3 | 212 | Cell division cycle 5-like protein |
5z57_L | 2e-76 | 2 | 178 | 3 | 212 | Cell division cycle 5-like protein |
5z58_L | 2e-76 | 2 | 178 | 3 | 212 | Cell division cycle 5-like protein |
6ff4_L | 2e-76 | 2 | 178 | 3 | 212 | Cell division cycle 5-like protein |
6ff7_L | 2e-76 | 2 | 178 | 3 | 212 | Cell division cycle 5-like protein |
6icz_L | 2e-76 | 2 | 178 | 3 | 212 | Cell division cycle 5-like protein |
6id0_L | 2e-76 | 2 | 178 | 3 | 212 | Cell division cycle 5-like protein |
6id1_L | 2e-76 | 2 | 178 | 3 | 212 | Cell division cycle 5-like protein |
6qdv_O | 2e-76 | 2 | 178 | 3 | 212 | Cell division cycle 5-like protein |
Search in ModeBase |
Functional Description ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Description | |||||
UniProt | Component of the MAC complex that probably regulates defense responses through transcriptional control and thereby is essential for plant innate immunity. Possesses a sequence specific DNA sequence 'CTCAGCG' binding activity. Involved in mRNA splicing and cell cycle control. May also play a role in the response to DNA damage. {ECO:0000250|UniProtKB:Q99459, ECO:0000269|PubMed:17298883, ECO:0000269|PubMed:17575050, ECO:0000269|PubMed:8917598}. |
Regulation -- PlantRegMap ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Upstream Regulator | Target Gene | ||||
PlantRegMap | Retrieve | - |
Annotation -- Protein ? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | ||||
Refseq | XP_003056512.1 | 3e-88 | predicted protein, partial | ||||
Refseq | XP_015875524.1 | 3e-86 | cell division cycle 5-like protein | ||||
Refseq | XP_019232628.1 | 3e-87 | PREDICTED: cell division cycle 5-like protein | ||||
Swissprot | P92948 | 9e-85 | CDC5L_ARATH; Cell division cycle 5-like protein | ||||
TrEMBL | A0A067DSG9 | 4e-87 | A0A067DSG9_CITSI; Uncharacterized protein | ||||
STRING | XP_003056512.1 | 1e-87 | (Micromonas pusilla) |
Best hit in Arabidopsis thaliana ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Hit ID | E-value | Description | ||||
AT1G09770.1 | 4e-87 | cell division cycle 5 |
Publications ? help Back to Top | |||
---|---|---|---|
|