PlantRegMap/PlantTFDB v5.0
Plant Transcription
Factor Database
|
Home TFext BLAST Prediction Download Help About Links PlantRegMap |
Transcription Factor Information
Basic Information? help Back to Top | |||||||||
---|---|---|---|---|---|---|---|---|---|
TF ID | Dca18364.1 | ||||||||
Organism | |||||||||
Taxonomic ID | |||||||||
Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; Caryophyllales; Caryophyllaceae; Caryophylleae; Dianthus
|
||||||||
Family | MYB | ||||||||
Protein Properties | Length: 205aa MW: 23693.6 Da PI: 6.9388 | ||||||||
Description | MYB family protein | ||||||||
Gene Model |
|
Signature Domain? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
No. | Domain | Score | E-value | Start | End | HMM Start | HMM End |
1 | Myb_DNA-binding | 65 | 1.4e-20 | 21 | 68 | 1 | 48 |
TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS Myb_DNA-binding 1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48 +g+WTteEd++lvd+v+++G++ Wkt+a + g++R++k+c++rw++yl Dca18364.1 21 KGSWTTEEDKKLVDYVEEFGPRKWKTVAFKAGLNRCGKSCRLRWLNYL 68 799*******************************************97 PP | |||||||
2 | Myb_DNA-binding | 52.9 | 8.7e-17 | 74 | 119 | 1 | 48 |
TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS Myb_DNA-binding 1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48 rg+ + eE++l+++++k+lG++ W++Ia +++ gRt++++k++w+++l Dca18364.1 74 RGNISDEEEDLILRLHKLLGNR-WSLIAGRLP-GRTDNEIKNYWNSHL 119 7899******************.*********.************986 PP |
Protein Features ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Database | Entry ID | E-value | Start | End | InterPro ID | Description |
PROSITE profile | PS51294 | 19.183 | 16 | 68 | IPR017930 | Myb domain |
SMART | SM00717 | 2.2E-14 | 20 | 70 | IPR001005 | SANT/Myb domain |
SuperFamily | SSF46689 | 4.03E-30 | 20 | 115 | IPR009057 | Homeodomain-like |
Pfam | PF00249 | 4.6E-18 | 21 | 68 | IPR001005 | SANT/Myb domain |
Gene3D | G3DSA:1.10.10.60 | 5.9E-25 | 22 | 75 | IPR009057 | Homeodomain-like |
CDD | cd00167 | 1.40E-10 | 23 | 68 | No hit | No description |
PROSITE profile | PS51294 | 25.772 | 69 | 123 | IPR017930 | Myb domain |
SMART | SM00717 | 4.3E-16 | 73 | 121 | IPR001005 | SANT/Myb domain |
Pfam | PF00249 | 4.5E-15 | 74 | 119 | IPR001005 | SANT/Myb domain |
Gene3D | G3DSA:1.10.10.60 | 3.1E-25 | 76 | 123 | IPR009057 | Homeodomain-like |
CDD | cd00167 | 3.16E-11 | 78 | 119 | No hit | No description |
Gene Ontology ? help Back to Top | ||||||
---|---|---|---|---|---|---|
GO Term | GO Category | GO Description | ||||
GO:0009957 | Biological Process | epidermal cell fate specification | ||||
GO:0010090 | Biological Process | trichome morphogenesis | ||||
GO:0045892 | Biological Process | negative regulation of transcription, DNA-templated | ||||
GO:0045893 | Biological Process | positive regulation of transcription, DNA-templated | ||||
GO:0048481 | Biological Process | plant ovule development | ||||
GO:0048629 | Biological Process | trichome patterning | ||||
GO:0003700 | Molecular Function | transcription factor activity, sequence-specific DNA binding | ||||
GO:0043565 | Molecular Function | sequence-specific DNA binding |
Sequence ? help Back to Top |
---|
Protein Sequence Length: 205 aa Download sequence Send to blast |
MAPKSNNREH HSTKRSSMVN KGSWTTEEDK KLVDYVEEFG PRKWKTVAFK AGLNRCGKSC 60 RLRWLNYLRP NIKRGNISDE EEDLILRLHK LLGNRWSLIA GRLPGRTDNE IKNYWNSHLS 120 KRVNQQETKT EMSFPPTTSS PTIMDESKGK TVKSVVMDES REATVGSEDT GLSFEINDLI 180 DFSSEGNCYS MDWVDEFLSF DELQY |
3D Structure ? help Back to Top | ||||||
---|---|---|---|---|---|---|
PDB ID | Evalue | Query Start | Query End | Hit Start | Hit End | Description |
1h8a_C | 7e-32 | 19 | 123 | 25 | 128 | MYB TRANSFORMING PROTEIN |
Search in ModeBase |
Functional Description ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Description | |||||
UniProt | Transcription activator, when associated with BHLH2/EGL3/MYC146 or BHLH12/MYC1. Involved in epidermal cell fate specification in roots and hypocotyl. Together with GL3 or BHLH2, promotes the formation of non-hair developing cells (atrichoblasts) et the N position in root epidermis. Regulates stomata spatial distribution in hypocotyls. Binds to the WER-binding sites (WBS) promoter regions and activates the transcription of target genes such as GL2 and of CPC. {ECO:0000269|PubMed:10589676, ECO:0000269|PubMed:11585796, ECO:0000269|PubMed:14627722, ECO:0000269|PubMed:15361138, ECO:0000269|PubMed:15795220, ECO:0000269|PubMed:16207757}. |
Regulation -- Description ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Description | |||||
UniProt | INDUCTION: Transcriptional activation correlates with reduced histone acetylation on H3 and H4 mediated by HDA18 in N cells. Repressed by CPC in hair cells (H position). {ECO:0000269|PubMed:11910008, ECO:0000269|PubMed:16176989}. |
Regulation -- PlantRegMap ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Upstream Regulator | Target Gene | ||||
PlantRegMap | Retrieve | - |
Annotation -- Protein ? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | ||||
Refseq | XP_010667031.1 | 1e-83 | PREDICTED: transcription factor MYB114-like | ||||
Swissprot | Q9SEI0 | 2e-52 | WER_ARATH; Transcription factor WER | ||||
TrEMBL | A0A1Q3BY67 | 3e-78 | A0A1Q3BY67_CEPFO; Myb_DNA-binding domain-containing protein | ||||
TrEMBL | A0A2I0IC31 | 3e-78 | A0A2I0IC31_PUNGR; Uncharacterized protein | ||||
STRING | XP_010667031.1 | 4e-83 | (Beta vulgaris) |
Best hit in Arabidopsis thaliana ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Hit ID | E-value | Description | ||||
AT5G14750.1 | 7e-55 | myb domain protein 66 |