PlantTFDB - Plant Transcription Factor Database @ CBI, PKU

PlantRegMap/PlantTFDB v5.0

Plant Transcription Factor Database

Transcription Factor Information

Basic Information | Signature Domain | Sequence |

Basic Information? help Back to Top

TF ID

Dca17019.1

Organism

Dianthus caryophyllus

Taxonomic ID

3570

Taxonomic Lineage

cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; Caryophyllales; Caryophyllaceae; Caryophylleae; Dianthus

Family

G2-like

Protein Properties

Length: 181aa MW: 20116.8 Da PI: 10.6845

Description

G2-like family protein

Gene Model

Gene Model ID	Type	Source	Coding Sequence
Dca17019.1	genome	DCA	View CDS

Signature Domain? help Back to Top

No.	Domain	Score	E-value	Start	End	HMM Start	HMM End
1	G2-like	76.4	3.8e-24	6	52	8	55
G2-like 8 peLHerFveaveqLGGsekAtPktilelmkvkgLtlehvkSHLQkYRl 55 p+ H++Fv av+qL G++kA+Pk+ilelm+v+gLt+e+v+SHLQkYRl Dca17019.1 6 PKWHRQFVVAVNQL-GIDKAVPKKILELMNVPGLTRENVASHLQKYRL 52 678*********.******************************8 PP

Protein Features ? help Back to Top

Database	Entry ID	E-value	Start	End	InterPro ID	Description
SuperFamily	SSF46689	6.63E-16	6	56	IPR009057	Homeodomain-like
Gene3D	G3DSA:1.10.10.60	1.7E-24	6	57	IPR009057	Homeodomain-like
TIGRFAMs	TIGR01557	2.5E-20	8	52	IPR006447	Myb domain, plants

Gene Ontology ? help Back to Top
GO Term	GO Category	GO Description
GO:0003677	Molecular Function	DNA binding

Sequence ? help Back to Top
Protein Sequence Length: 181 aa Download sequence Send to blast
SSQKNPKWHR QFVVAVNQLG IDKAVPKKIL ELMNVPGLTR ENVASHLQKY RLYLRRLSGV 60 SQHQGSGLNG SFMSQDGGFG AMSQLSGIDL QALHATAQLS SQTLAAYTRL PPIKPSMSMP 120 FADQRNLFSF ENTATSRYVD GQQQQQQQYS KQMNLLHGIP TTLESKQLAG LNQSAQRNNF 180 V

3D Structure ? help Back to Top

PDB ID	Evalue	Query Start	Query End	Hit Start	Hit End	Description
1irz_A	6e-18	1	58	1	64	ARR10-B
Search in ModeBase

Functional Description ? help Back to Top
Source	Description
UniProt	Transcriptional activator that binds specifically to the DNA sequence 5'-[AG]GATT-3'. Functions as a response regulator involved in His-to-Asp phosphorelay signal transduction system. Phosphorylation of the Asp residue in the receiver domain activates the ability of the protein to promote the transcription of target genes. Could directly activate some type-A response regulators in response to cytokinins. Involved in the expression of nuclear genes for components of mitochondrial complex I. Promotes cytokinin-mediated leaf longevity. Involved in the ethylene signaling pathway in an ETR1-dependent manner and in the cytokinin signaling pathway. {ECO:0000269\|PubMed:11370868, ECO:0000269\|PubMed:11574878, ECO:0000269\|PubMed:15282545, ECO:0000269\|PubMed:16407152}.

Regulation -- PlantRegMap ? help Back to Top
Source	Upstream Regulator	Target Gene
PlantRegMap	Retrieve	-

Annotation -- Protein ? help Back to Top
Source	Hit ID	E-value	Description
Refseq	XP_021730281.1	3e-84	two-component response regulator ARR2-like isoform X1
Refseq	XP_021730283.1	3e-84	two-component response regulator ARR2-like isoform X3
Swissprot	Q9ZWJ9	1e-49	ARR2_ARATH; Two-component response regulator ARR2
TrEMBL	A0A0K9RPY9	2e-74	A0A0K9RPY9_SPIOL; Two-component response regulator
TrEMBL	A0A0K9RRQ2	2e-74	A0A0K9RRQ2_SPIOL; Two-component response regulator
STRING	XP_010670914.1	2e-82	(Beta vulgaris)

Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID	E-value	Description
AT3G16857.1	1e-51	response regulator 1

Publications ? help Back to Top
Takahashi N, et al. Cytokinins control endocycle onset by promoting the expression of an APC/C activator in Arabidopsis roots. Curr. Biol., 2013. 23(18): p. 1812-7 [PMID:24035544] Ge XM, et al. Heterotrimeric G protein mediates ethylene-induced stomatal closure via hydrogen peroxide synthesis in Arabidopsis. Plant J., 2015. 82(1): p. 138-50 [PMID:25704455] Takahashi N,Umeda M Cytokinins promote onset of endoreplication by controlling cell cycle machinery. Plant Signal Behav, 2014. 9(8): p. e29396 [PMID:25763620] Kobayashi K, et al. Shoot Removal Induces Chloroplast Development in Roots via Cytokinin Signaling. Plant Physiol., 2017. 173(4): p. 2340-2355 [PMID:28193764] Arnaud D, et al. Cytokinin-Mediated Regulation of Reactive Oxygen Species Homeostasis Modulates Stomatal Immunity in Arabidopsis. Plant Cell, 2017. 29(3): p. 543-559 [PMID:28254779] Zhang TQ, et al. A Two-Step Model for de Novo Activation of WUSCHEL during Plant Shoot Regeneration. Plant Cell, 2017. 29(5): p. 1073-1087 [PMID:28389585] Meng WJ, et al. Type-B ARABIDOPSIS RESPONSE REGULATORs Specify the Shoot Stem Cell Niche by Dual Regulation of WUSCHEL. Plant Cell, 2017. 29(6): p. 1357-1372 [PMID:28576846] Zhang F,May A,Irish VF Type-B ARABIDOPSIS RESPONSE REGULATORs Directly Activate WUSCHEL. Trends Plant Sci., 2017. 22(10): p. 815-817 [PMID:28886911] Takatsuka H,Higaki T,Umeda M Actin Reorganization Triggers Rapid Cell Elongation in Roots. Plant Physiol., 2018. 178(3): p. 1130-1141 [PMID:30185441]