PlantRegMap/PlantTFDB v5.0
Plant Transcription
Factor Database
|
Home TFext BLAST Prediction Download Help About Links PlantRegMap |
Transcription Factor Information
Basic Information? help Back to Top | |||||||||
---|---|---|---|---|---|---|---|---|---|
TF ID | DCAR_030745 | ||||||||
Common Name | DcMYB1 | ||||||||
Organism | |||||||||
Taxonomic ID | |||||||||
Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; campanulids; Apiales; Apiineae; Apiaceae; Apioideae; Scandiceae; Daucinae; Daucus
|
||||||||
Family | MYB | ||||||||
Protein Properties | Length: 234aa MW: 26589.9 Da PI: 6.3677 | ||||||||
Description | MYB family protein | ||||||||
Gene Model |
|
Signature Domain? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
No. | Domain | Score | E-value | Start | End | HMM Start | HMM End |
1 | Myb_DNA-binding | 52.1 | 1.5e-16 | 14 | 61 | 1 | 48 |
TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS Myb_DNA-binding 1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48 +g+W+ eEd++l+ ++q G g+W++ ++ g+ R++k+c++rw +yl DCAR_030745 14 KGPWSSEEDQILISFIQQNGHGNWRALPKLAGLLRCGKSCRLRWINYL 61 79******************************99************97 PP | |||||||
2 | Myb_DNA-binding | 55.2 | 1.7e-17 | 67 | 112 | 1 | 48 |
TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS Myb_DNA-binding 1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48 rg++++eE+e +++++++lG++ W++Ia++++ gRt++++k+ w+++l DCAR_030745 67 RGNFSKEEEETIIELHQKLGNK-WAAIAAKLP-GRTDNEIKNVWHTHL 112 89********************.*********.************986 PP |
Protein Features ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Database | Entry ID | E-value | Start | End | InterPro ID | Description |
Gene3D | G3DSA:1.10.10.60 | 7.9E-24 | 5 | 64 | IPR009057 | Homeodomain-like |
PROSITE profile | PS51294 | 15.907 | 9 | 61 | IPR017930 | Myb domain |
SuperFamily | SSF46689 | 1.95E-30 | 10 | 108 | IPR009057 | Homeodomain-like |
SMART | SM00717 | 9.0E-13 | 13 | 63 | IPR001005 | SANT/Myb domain |
Pfam | PF00249 | 7.0E-15 | 14 | 61 | IPR001005 | SANT/Myb domain |
CDD | cd00167 | 4.43E-9 | 16 | 61 | No hit | No description |
PROSITE profile | PS51294 | 26.487 | 62 | 116 | IPR017930 | Myb domain |
Gene3D | G3DSA:1.10.10.60 | 1.9E-27 | 65 | 117 | IPR009057 | Homeodomain-like |
SMART | SM00717 | 3.3E-15 | 66 | 114 | IPR001005 | SANT/Myb domain |
Pfam | PF00249 | 2.4E-16 | 67 | 112 | IPR001005 | SANT/Myb domain |
CDD | cd00167 | 2.42E-10 | 69 | 112 | No hit | No description |
Gene Ontology ? help Back to Top | ||||||
---|---|---|---|---|---|---|
GO Term | GO Category | GO Description | ||||
GO:0009651 | Biological Process | response to salt stress | ||||
GO:0009723 | Biological Process | response to ethylene | ||||
GO:0009733 | Biological Process | response to auxin | ||||
GO:0009751 | Biological Process | response to salicylic acid | ||||
GO:0009753 | Biological Process | response to jasmonic acid | ||||
GO:0010200 | Biological Process | response to chitin | ||||
GO:0046686 | Biological Process | response to cadmium ion | ||||
GO:0003677 | Molecular Function | DNA binding |
Sequence ? help Back to Top |
---|
Protein Sequence Length: 234 aa Download sequence Send to blast |
MGRAPCCEKM GLKKGPWSSE EDQILISFIQ QNGHGNWRAL PKLAGLLRCG KSCRLRWINY 60 LRPDIKRGNF SKEEEETIIE LHQKLGNKWA AIAAKLPGRT DNEIKNVWHT HLKKKLKNYD 120 QVKNESNVKM QVESENRRNS PQHSTSELSS VTDSSAKAKC VIKSEQNTEL SESSKIPEID 180 ASFWSEEFTI NNQDKGVPGI IEEFQESGNV DAEMDFWCNL FSGAEDFKDL PEF* |
3D Structure ? help Back to Top | ||||||
---|---|---|---|---|---|---|
PDB ID | Evalue | Query Start | Query End | Hit Start | Hit End | Description |
1gv2_A | 1e-27 | 12 | 116 | 2 | 105 | MYB PROTO-ONCOGENE PROTEIN |
1mse_C | 1e-27 | 12 | 116 | 2 | 105 | C-Myb DNA-Binding Domain |
1msf_C | 1e-27 | 12 | 116 | 2 | 105 | C-Myb DNA-Binding Domain |
Search in ModeBase |
Functional Description ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Description | |||||
UniProt | Transcription activator that regulates freezing tolerance by affecting expression of CBF genes. {ECO:0000269|PubMed:24415840}. |
Binding Motif ? help Back to Top | |||
---|---|---|---|
Motif ID | Method | Source | Motif file |
MP00375 | DAP | Transfer from AT3G23250 | Download |
Regulation -- Description ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Description | |||||
UniProt | INDUCTION: Induced by salicylic acid (SA), jasmonic acid (JA), salt (NaCl), ethylene and auxin (IAA) (PubMed:16463103). Down-regulated by cold treatment (PubMed:24415840). {ECO:0000269|PubMed:16463103, ECO:0000269|PubMed:24415840}. |
Regulation -- PlantRegMap ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Upstream Regulator | Target Gene | ||||
PlantRegMap | Retrieve | Retrieve |
Annotation -- Nucleotide ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | |||
GenBank | AB218778 | 0.0 | AB218778.1 Daucus carota mRNA for transcription factor DcMYB1, complete cds. |
Annotation -- Protein ? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | ||||
Refseq | XP_017224603.1 | 1e-173 | PREDICTED: myb-related protein Myb4-like | ||||
Swissprot | Q9SJX8 | 2e-78 | MYB14_ARATH; Transcription factor MYB14 | ||||
TrEMBL | A0A175YHM5 | 1e-172 | A0A175YHM5_DAUCS; Uncharacterized protein | ||||
TrEMBL | Q2V0V6 | 1e-172 | Q2V0V6_DAUCA; Transcription factor DcMYB1 | ||||
STRING | XP_009629052.1 | 5e-91 | (Nicotiana tomentosiformis) |
Orthologous Group ? help Back to Top | |||
---|---|---|---|
Lineage | Orthologous Group ID | Taxa Number | Gene Number |
Asterids | OGEA12 | 24 | 2154 |
Best hit in Arabidopsis thaliana ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Hit ID | E-value | Description | ||||
AT2G31180.1 | 2e-79 | myb domain protein 14 |
Link Out ? help Back to Top | |
---|---|
Phytozome | DCAR_030745 |
Publications ? help Back to Top | |||
---|---|---|---|
|