PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID DCAR_028018
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; campanulids; Apiales; Apiineae; Apiaceae; Apioideae; Scandiceae; Daucinae; Daucus
Family MYB
Protein Properties Length: 428aa    MW: 49181.7 Da    PI: 7.9319
Description MYB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
DCAR_028018genomeARS-USDAView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding51.81.8e-16187233148
                      TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
  Myb_DNA-binding   1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48 
                      +g WT+eEd ll + vk++G + W+ Ia ++  gR +kqc++rw+++l
      DCAR_028018 187 KGQWTAEEDRLLTHMVKKYGVRKWSHIATMLK-GRIGKQCRERWHNHL 233
                      799****************************9.*************97 PP

2Myb_DNA-binding54.82.2e-17241281345
                      SS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHH CS
  Myb_DNA-binding   3 rWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwq 45 
                       W+++Ed +lv+a+++ G++ W+ Ia++++ gRt++++k++w+
      DCAR_028018 241 LWSEDEDRILVEAHAKVGNK-WADIAKRLP-GRTENSIKNHWN 281
                      6*******************.*********.***********8 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5129420.873180233IPR017930Myb domain
SuperFamilySSF466893.56E-30186280IPR009057Homeodomain-like
SMARTSM007177.0E-17186235IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.606.2E-26188240IPR009057Homeodomain-like
CDDcd001674.32E-15190233No hitNo description
PfamPF139212.0E-16190247No hitNo description
PROSITE profilePS5129427.375234288IPR017930Myb domain
SMARTSM007177.3E-17238286IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.601.2E-21241287IPR009057Homeodomain-like
CDDcd001677.16E-13242284No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 428 aa     Download sequence    Send to blast
MEFDPCYRED HVHQPVLLPN NYIKPEIDHN FSLDICSPKG FFQDNCQVLD QLSFSGSSFY  60
YSPNKICAPN GFCEPYDPFL LASAKNFDFY DQPKPFEENG SSSFLQNSSY LHVDGLFNTY  120
KTTPELLNAS NYPNSAKMPG VVPDEGSCVT TDNKILGTKK HFGKKYNDST LTSTKPSKLK  180
KKLKSSKGQW TAEEDRLLTH MVKKYGVRKW SHIATMLKGR IGKQCRERWH NHLRPDIKKD  240
LWSEDEDRIL VEAHAKVGNK WADIAKRLPG RTENSIKNHW NATKRRQYSR RKCRTKWPRP  300
SSILQNYIKS LNLDIAKPTN YRKKSTTATT PNLNIPAMKT QHLQETKEFC PSYSDGLKEL  360
CEFDFVENPF EGDSIDALLE DLPTIEAPLV LEDNYFDMDA NSHDQVPSLM QVKKDLDLME  420
MISEINI*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1mse_C2e-441872874104C-Myb DNA-Binding Domain
1msf_C2e-441872874104C-Myb DNA-Binding Domain
Search in ModeBase
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
1178184LKKKLKS
Functional Description ? help Back to Top
Source Description
UniProtTranscription factor that binds to the motif 5'-GTAACNT-3' in the promoter of target genes (e.g. DD11 and DD18) and promotes their expression within synergid cells (e.g. in the filiform apparatus) in ovules (PubMed:16214903, PubMed:17693534, PubMed:18410484, PubMed:17937500). Required for the formation of the filiform apparatus during synergid cell differentiation in the female gametophyte (PubMed:16214903). Involved in pollen tube guidance to the micropyle (PubMed:16214903, PubMed:17937500, PubMed:23093426). {ECO:0000269|PubMed:16214903, ECO:0000269|PubMed:17693534, ECO:0000269|PubMed:17937500, ECO:0000269|PubMed:18410484, ECO:0000269|PubMed:23093426}.
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_017221504.10.0PREDICTED: transcription factor MYB98-like
SwissprotQ9S7L22e-73MYB98_ARATH; Transcription factor MYB98
TrEMBLA0A175YMU00.0A0A175YMU0_DAUCS; Uncharacterized protein
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
AsteridsOGEA31502349
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G18770.11e-72myb domain protein 98
Publications ? help Back to Top
  1. Mendes MA, et al.
    Live and let die: a REM complex promotes fertilization through synergid cell death in Arabidopsis.
    Development, 2016. 143(15): p. 2780-90
    [PMID:27338615]