PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID DCAR_021570
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; campanulids; Apiales; Apiineae; Apiaceae; Apioideae; Scandiceae; Daucinae; Daucus
Family MYB
Protein Properties Length: 437aa    MW: 50011.2 Da    PI: 8.8673
Description MYB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
DCAR_021570genomeARS-USDAView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding57.92.3e-18189235148
                      TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
  Myb_DNA-binding   1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48 
                      +g WT+eEd llvd vk++G + W+ Ia+++  gR +kqc++rw+++l
      DCAR_021570 189 KGQWTAEEDRLLVDMVKKYGVRKWSHIASMLK-GRIGKQCRERWHNHL 235
                      799****************************9.*************97 PP

2Myb_DNA-binding53.74.7e-17243283345
                      SS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHH CS
  Myb_DNA-binding   3 rWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwq 45 
                       W+++Ed +l++a+ + G++ W+ Ia++++ gRt++++k++w+
      DCAR_021570 243 LWSEDEDRILIQAHSKVGNK-WAEIAKRLP-GRTENSIKNHWN 283
                      6*******************.*********.***********8 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5129427.873182239IPR017930Myb domain
SMARTSM007175.4E-18188237IPR001005SANT/Myb domain
SuperFamilySSF466893.1E-31188282IPR009057Homeodomain-like
Gene3DG3DSA:1.10.10.604.2E-27190242IPR009057Homeodomain-like
CDDcd001674.60E-16192235No hitNo description
PfamPF139214.2E-17192249No hitNo description
SMARTSM007173.8E-17240288IPR001005SANT/Myb domain
PROSITE profilePS5129422.574240290IPR017930Myb domain
Gene3DG3DSA:1.10.10.604.0E-22243289IPR009057Homeodomain-like
CDDcd001671.91E-13244286No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0010183Biological Processpollen tube guidance
GO:0045697Biological Processregulation of synergid differentiation
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 437 aa     Download sequence    Send to blast
MELDTHHKED HHVYQSILLP GNYIKPEIDN DFSVNIGSSK GFYQDNYQTL DQFSFTGSSS  60
SYNHPNKISS PNVFSDPYDP FIYPSGKSYD IFDQFKPFEE NGGSSFVQNS SDLQVGGFVN  120
NPTAGKVDCN ASDQRRRLGK MSVMVPDEGS CVTADHKNIP GKYFGKRSDA FTSSSTKPSK  180
NTKKLKSSKG QWTAEEDRLL VDMVKKYGVR KWSHIASMLK GRIGKQCRER WHNHLRPDIK  240
KDLWSEDEDR ILIQAHSKVG NKWAEIAKRL PGRTENSIKN HWNATKRRQY SRRKCRTKWP  300
RPSSLLQHYI KSLHLDNTKP TNYRRKSSSI NKTPAEVIPK LNIPTTKPPN WSEKAEFCPN  360
FDDDLKELAE LNFMENPFEG VSIDDLLEDL PPIKTPPVED SGIDMNLDSN DQRPTLMQCQ  420
VKKDLDLMEM ISQINM*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1gv2_A3e-441892894104MYB PROTO-ONCOGENE PROTEIN
1mse_C4e-441892894104C-Myb DNA-Binding Domain
1msf_C4e-441892894104C-Myb DNA-Binding Domain
Search in ModeBase
Functional Description ? help Back to Top
Source Description
UniProtTranscription factor that binds to the motif 5'-GTAACNT-3' in the promoter of target genes (e.g. DD11 and DD18) and promotes their expression within synergid cells (e.g. in the filiform apparatus) in ovules (PubMed:16214903, PubMed:17693534, PubMed:18410484, PubMed:17937500). Required for the formation of the filiform apparatus during synergid cell differentiation in the female gametophyte (PubMed:16214903). Involved in pollen tube guidance to the micropyle (PubMed:16214903, PubMed:17937500, PubMed:23093426). {ECO:0000269|PubMed:16214903, ECO:0000269|PubMed:17693534, ECO:0000269|PubMed:17937500, ECO:0000269|PubMed:18410484, ECO:0000269|PubMed:23093426}.
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00442DAPTransfer from AT4G18770Download
Motif logo
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieveRetrieve
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_017256574.10.0PREDICTED: transcription factor MYB98-like
SwissprotQ9S7L21e-76MYB98_ARATH; Transcription factor MYB98
TrEMBLA0A164VZ440.0A0A164VZ44_DAUCS; Uncharacterized protein
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
AsteridsOGEA31502349
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G18770.11e-74myb domain protein 98
Publications ? help Back to Top
  1. Mendes MA, et al.
    Live and let die: a REM complex promotes fertilization through synergid cell death in Arabidopsis.
    Development, 2016. 143(15): p. 2780-90
    [PMID:27338615]