PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID DCAR_021496
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; campanulids; Apiales; Apiineae; Apiaceae; Apioideae; Scandiceae; Daucinae; Daucus
Family BBR-BPC
Protein Properties Length: 295aa    MW: 32894.9 Da    PI: 8.5548
Description BBR-BPC family protein
Gene Model
Gene Model ID Type Source Coding Sequence
DCAR_021496genomeARS-USDAView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1GAGA_bind305.61.7e-93129429301
    GAGA_bind  29 mssiaerdakirernlalsekkaavaerdmaflqrdkalaernkalverdnkllalllvensla.....salpvgvqvlsgtksidslqqlse.pqle 120
                  m+++aerda+irern+al e+k a+aerdma lqrd+al+er+ a+ erd+++++l ++  s++     s++ ++ +v +gtksi++ qq++   +++
  DCAR_021496   1 MAIMAERDAAIRERNMALEERKRAFAERDMAMLQRDAALQERDSAMRERDEAMATLRYKGGSSVnenntSSDFPNNGVGRGTKSIQEDQQMHImYDMS 98 
                  899******************************************************99887776766556666788999999999988855444444 PP

    GAGA_bind 121 dsavelreeeklealpieeaaeeakekkkkkkrqrakk.pkek.kakkkkkksekskkkvkkesader.................skaekksidlvln 199
                    ++  +   ++++++i++ ++e+ + +k+k+++++k+ pk++ k++++ +k++++ kk+ ++s                     s+    +  l ln
  DCAR_021496  99 SGKYS-PGDIMTDSYQINDVPTEHVKPRKVKQTEENKEfPKKPaKSRRVSRKGAENLKKEGSAS---AsnickieqdlgadenqgSQIAGWKDSLELN 192
                  44444.5555667777777777777666666544444313332122333333333333333333...12357788888888888855544445799** PP

    GAGA_bind 200 gvslDestlPvPvCsCtGalrqCYkWGnGGWqSaCCtttiSvyPLPvstkrrgaRiagrKmSqgafkklLekLaaeGydlsnpvDLkdhWAkHGtnkf 297
                  +v++D+s++P+PvCsCtG+++ CYkWGnGGWqSaCCttt+S+yPLP+++++r +R++grKmS+gaf+klL +L +eGydls p+DLkdhWAkHGtn++
  DCAR_021496 193 QVNFDDSAMPIPVCSCTGVPQPCYKWGNGGWQSACCTTTMSMYPLPQVSNKRYSRVGGRKMSGGAFSKLLTRLHDEGYDLSSPLDLKDHWAKHGTNRY 290
                  ************************************************************************************************** PP

    GAGA_bind 298 vtir 301
                   t++
  DCAR_021496 291 STVK 294
                  **97 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PfamPF062171.5E-821294IPR010409GAGA-binding transcriptional activator
SMARTSM012264.1E-961294IPR010409GAGA-binding transcriptional activator
Sequence ? help Back to Top
Protein Sequence    Length: 295 aa     Download sequence    Send to blast
MAIMAERDAA IRERNMALEE RKRAFAERDM AMLQRDAALQ ERDSAMRERD EAMATLRYKG  60
GSSVNENNTS SDFPNNGVGR GTKSIQEDQQ MHIMYDMSSG KYSPGDIMTD SYQINDVPTE  120
HVKPRKVKQT EENKEFPKKP AKSRRVSRKG AENLKKEGSA SASNICKIEQ DLGADENQGS  180
QIAGWKDSLE LNQVNFDDSA MPIPVCSCTG VPQPCYKWGN GGWQSACCTT TMSMYPLPQV  240
SNKRYSRVGG RKMSGGAFSK LLTRLHDEGY DLSSPLDLKD HWAKHGTNRY STVK*
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
1136142PKKPAKS
Functional Description ? help Back to Top
Source Description
UniProtTranscriptional regulator that specifically binds to GA-rich elements (GAGA-repeats) present in regulatory sequences of genes involved in developmental processes. {ECO:0000269|PubMed:14731261}.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_017214893.10.0PREDICTED: protein BASIC PENTACYSTEINE6-like
SwissprotQ8L9992e-82BPC6_ARATH; Protein BASIC PENTACYSTEINE6
TrEMBLA0A161YE950.0A0A161YE95_DAUCS; Uncharacterized protein
STRINGXP_009789611.11e-121(Nicotiana sylvestris)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
AsteridsOGEA80622230
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G42520.11e-84basic pentacysteine 6