PlantRegMap/PlantTFDB v5.0
Plant Transcription
Factor Database
|
Home TFext BLAST Prediction Download Help About Links PlantRegMap |
Transcription Factor Information
Basic Information? help Back to Top | |||||||||
---|---|---|---|---|---|---|---|---|---|
TF ID | DCAR_020937 | ||||||||
Organism | |||||||||
Taxonomic ID | |||||||||
Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; campanulids; Apiales; Apiineae; Apiaceae; Apioideae; Scandiceae; Daucinae; Daucus
|
||||||||
Family | MYB | ||||||||
Protein Properties | Length: 211aa MW: 23094.4 Da PI: 6.5185 | ||||||||
Description | MYB family protein | ||||||||
Gene Model |
|
Signature Domain? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
No. | Domain | Score | E-value | Start | End | HMM Start | HMM End |
1 | Myb_DNA-binding | 58.5 | 1.5e-18 | 39 | 84 | 1 | 47 |
TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHH CS Myb_DNA-binding 1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqky 47 rg+W++eEd++l ++v+++G ++W++I++++ gR++k+c++rw + DCAR_020937 39 RGPWSAEEDKILSQLVERFGAKNWSLISKYIK-GRSGKSCRLRWCNQ 84 89*****************************9.***********985 PP | |||||||
2 | Myb_DNA-binding | 55.8 | 1.1e-17 | 93 | 135 | 3 | 47 |
SS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHH CS Myb_DNA-binding 3 rWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqky 47 ++++ Ede ++ a++++G++ W+tIar ++ gRt++ +k++w++ DCAR_020937 93 PFSQAEDEMILAAHEKYGNR-WATIARLLP-GRTDNAVKNHWNST 135 79******************.*********.***********986 PP |
Protein Features ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Database | Entry ID | E-value | Start | End | InterPro ID | Description |
PROSITE profile | PS51294 | 19.342 | 34 | 85 | IPR017930 | Myb domain |
SuperFamily | SSF46689 | 6.11E-32 | 37 | 132 | IPR009057 | Homeodomain-like |
SMART | SM00717 | 4.9E-16 | 38 | 87 | IPR001005 | SANT/Myb domain |
Gene3D | G3DSA:1.10.10.60 | 1.2E-24 | 40 | 92 | IPR009057 | Homeodomain-like |
CDD | cd00167 | 3.02E-15 | 41 | 83 | No hit | No description |
Pfam | PF13921 | 2.8E-18 | 42 | 100 | No hit | No description |
PROSITE profile | PS51294 | 25.569 | 86 | 140 | IPR017930 | Myb domain |
SMART | SM00717 | 4.3E-16 | 90 | 138 | IPR001005 | SANT/Myb domain |
Gene3D | G3DSA:1.10.10.60 | 1.0E-23 | 93 | 139 | IPR009057 | Homeodomain-like |
CDD | cd00167 | 3.56E-13 | 93 | 136 | No hit | No description |
Gene Ontology ? help Back to Top | ||||||
---|---|---|---|---|---|---|
GO Term | GO Category | GO Description | ||||
GO:0003677 | Molecular Function | DNA binding |
Sequence ? help Back to Top |
---|
Protein Sequence Length: 211 aa Download sequence Send to blast |
MEPFNISFSV HTSSDSSSSD SSSSCTKAPG NVDKGEKIRG PWSAEEDKIL SQLVERFGAK 60 NWSLISKYIK GRSGKSCRLR WCNQLSPDVQ HRPFSQAEDE MILAAHEKYG NRWATIARLL 120 PGRTDNAVKN HWNSTLKRRR QGNNENEQNR SSEDEAREVA NAMDVGNVEC GASGSGDMNV 180 DPNEVDPMTV LTLAPPGSSS GGLPEQRGDR * |
3D Structure ? help Back to Top | ||||||
---|---|---|---|---|---|---|
PDB ID | Evalue | Query Start | Query End | Hit Start | Hit End | Description |
1a5j_A | 2e-41 | 38 | 139 | 6 | 107 | B-MYB |
Search in ModeBase |
Functional Description ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Description | |||||
UniProt | Transcription factor that functions in salt stress response. Acts as negative regulator of NHX7/SOS1 and CBL4/SOS3 induction in response to salt stress (PubMed:23809151). In response to auxin, activates the transcription of the auxin-responsive gene IAA19. The IAA19 transcription activation by MYB73 is enhanced by direct interaction between MYB73 and PYL8 (PubMed:24894996). {ECO:0000269|PubMed:23809151, ECO:0000269|PubMed:24894996}. |
Regulation -- Description ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Description | |||||
UniProt | INDUCTION: Induced by salt stress. {ECO:0000269|PubMed:23809151}. |
Regulation -- PlantRegMap ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Upstream Regulator | Target Gene | ||||
PlantRegMap | Retrieve | - |
Annotation -- Protein ? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | ||||
Refseq | XP_017257456.1 | 1e-155 | PREDICTED: transcription factor MYB44-like | ||||
Swissprot | O23160 | 9e-52 | MYB73_ARATH; Transcription factor MYB73 | ||||
TrEMBL | A0A164WF48 | 1e-154 | A0A164WF48_DAUCS; Uncharacterized protein | ||||
STRING | EMJ25026 | 7e-71 | (Prunus persica) |
Orthologous Group ? help Back to Top | |||
---|---|---|---|
Lineage | Orthologous Group ID | Taxa Number | Gene Number |
Asterids | OGEA7950 | 21 | 31 |
Best hit in Arabidopsis thaliana ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Hit ID | E-value | Description | ||||
AT4G37260.1 | 8e-53 | myb domain protein 73 |
Link Out ? help Back to Top | |
---|---|
Phytozome | DCAR_020937 |
Publications ? help Back to Top | |||
---|---|---|---|
|