PlantRegMap/PlantTFDB v5.0
Plant Transcription
Factor Database
|
Home TFext BLAST Prediction Download Help About Links PlantRegMap |
Transcription Factor Information
Basic Information? help Back to Top | |||||||||
---|---|---|---|---|---|---|---|---|---|
TF ID | DCAR_019112 | ||||||||
Organism | |||||||||
Taxonomic ID | |||||||||
Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; campanulids; Apiales; Apiineae; Apiaceae; Apioideae; Scandiceae; Daucinae; Daucus
|
||||||||
Family | MYB | ||||||||
Protein Properties | Length: 171aa MW: 18945.6 Da PI: 9.1936 | ||||||||
Description | MYB family protein | ||||||||
Gene Model |
|
Signature Domain? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
No. | Domain | Score | E-value | Start | End | HMM Start | HMM End |
1 | Myb_DNA-binding | 51.1 | 3.2e-16 | 6 | 53 | 1 | 48 |
TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS Myb_DNA-binding 1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48 + rWT++Ed lv +++++G +W++++ g++R++k+c+ rw ++l DCAR_019112 6 KSRWTPDEDIMLVSYIQEHGASNWSLVPGNAGLNRSGKSCRFRWMNHL 53 68********************************************97 PP | |||||||
2 | Myb_DNA-binding | 49.6 | 9.2e-16 | 59 | 104 | 1 | 48 |
TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS Myb_DNA-binding 1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48 rg++T E+++++++ ++lG++ W+ Ia++++ gRt++ +k++w+++l DCAR_019112 59 RGKFTHHEEQIIIHYQALLGNR-WADIAAHLP-GRTDNGVKNYWHTHL 104 89********************.*********.************986 PP |
Protein Features ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Database | Entry ID | E-value | Start | End | InterPro ID | Description |
PROSITE profile | PS51294 | 17.519 | 1 | 53 | IPR017930 | Myb domain |
SuperFamily | SSF46689 | 2.17E-28 | 3 | 100 | IPR009057 | Homeodomain-like |
SMART | SM00717 | 5.2E-12 | 5 | 55 | IPR001005 | SANT/Myb domain |
Pfam | PF00249 | 1.4E-14 | 6 | 53 | IPR001005 | SANT/Myb domain |
Gene3D | G3DSA:1.10.10.60 | 1.2E-22 | 8 | 60 | IPR009057 | Homeodomain-like |
CDD | cd00167 | 2.21E-11 | 8 | 53 | No hit | No description |
PROSITE profile | PS51294 | 24.962 | 54 | 108 | IPR017930 | Myb domain |
SMART | SM00717 | 2.2E-13 | 58 | 106 | IPR001005 | SANT/Myb domain |
Pfam | PF00249 | 7.7E-14 | 59 | 104 | IPR001005 | SANT/Myb domain |
Gene3D | G3DSA:1.10.10.60 | 3.0E-24 | 61 | 108 | IPR009057 | Homeodomain-like |
CDD | cd00167 | 7.51E-11 | 61 | 104 | No hit | No description |
Gene Ontology ? help Back to Top | ||||||
---|---|---|---|---|---|---|
GO Term | GO Category | GO Description | ||||
GO:0003677 | Molecular Function | DNA binding |
Sequence ? help Back to Top |
---|
Protein Sequence Length: 171 aa Download sequence Send to blast |
MARLPKSRWT PDEDIMLVSY IQEHGASNWS LVPGNAGLNR SGKSCRFRWM NHLRPGINRG 60 KFTHHEEQII IHYQALLGNR WADIAAHLPG RTDNGVKNYW HTHLKKKLDI VNGHVDEAMG 120 DPIAAPVYQV SPIMVTVPAP NFAPGCEGFD YPSIARAPSF APAPNACTRT * |
3D Structure ? help Back to Top | ||||||
---|---|---|---|---|---|---|
PDB ID | Evalue | Query Start | Query End | Hit Start | Hit End | Description |
1a5j_A | 6e-28 | 4 | 109 | 5 | 109 | B-MYB |
Search in ModeBase |
Functional Description ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Description | |||||
UniProt | Transcription activator involved in the activation of cuticular wax biosynthesis under drought stress. Binds directly to the promoters of genes involved in cuticular wax biosynthesis. Transactivates WSD1, KCS2/DAISY, CER1, CER2, FAR3 and ECR genes (PubMed:25305760, PubMed:27577115). Functions together with MYB96 in the activation of cuticular wax biosynthesis (PubMed:27577115). {ECO:0000269|PubMed:25305760, ECO:0000269|PubMed:27577115}. |
Regulation -- Description ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Description | |||||
UniProt | INDUCTION: Induced by salt stress, osmotic shock and abscisic acid (ABA). {ECO:0000269|PubMed:25305760}. |
Regulation -- PlantRegMap ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Upstream Regulator | Target Gene | ||||
PlantRegMap | Retrieve | - |
Annotation -- Protein ? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | ||||
Refseq | XP_017245833.1 | 1e-70 | PREDICTED: transcription factor MYB30-like | ||||
Swissprot | Q9SN78 | 4e-50 | MYB94_ARATH; Transcription factor MYB94 | ||||
TrEMBL | A0A162A5Y6 | 1e-125 | A0A162A5Y6_DAUCS; Uncharacterized protein | ||||
STRING | XP_010546059.1 | 7e-51 | (Tarenaya hassleriana) | ||||
STRING | GSMUA_Achr7P21010_001 | 5e-51 | (Musa acuminata) |
Orthologous Group ? help Back to Top | |||
---|---|---|---|
Lineage | Orthologous Group ID | Taxa Number | Gene Number |
Asterids | OGEA12 | 24 | 2154 |
Best hit in Arabidopsis thaliana ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Hit ID | E-value | Description | ||||
AT3G47600.1 | 2e-52 | myb domain protein 94 |
Link Out ? help Back to Top | |
---|---|
Phytozome | DCAR_019112 |
Publications ? help Back to Top | |||
---|---|---|---|
|