PlantTFDB - Plant Transcription Factor Database @ CBI, PKU

PlantRegMap/PlantTFDB v5.0

Plant Transcription Factor Database

Transcription Factor Information

Basic Information | Signature Domain | Sequence |

Basic Information? help Back to Top

TF ID

DCAR_019111

Organism

Daucus carota

Taxonomic ID

4039

Taxonomic Lineage

cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; campanulids; Apiales; Apiineae; Apiaceae; Apioideae; Scandiceae; Daucinae; Daucus

Family

MYB

Protein Properties

Length: 210aa MW: 23108.5 Da PI: 10.0118

Description

MYB family protein

Gene Model

Gene Model ID	Type	Source	Coding Sequence
DCAR_019111	genome	ARS-USDA	View CDS

Signature Domain? help Back to Top

No.	Domain	Score	E-value	Start	End	HMM Start	HMM End
1	Myb_DNA-binding	50	7e-16	6	53	1	48
TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS Myb_DNA-binding 1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48 + rWT +Ed lv +v+++G +W++++ g++R++k+c+ rw ++l DCAR_019111 6 KSRWTLDEDIMLVSYVQEHGASNWSLVPGNAGLNRSGKSCRFRWMNHL 53 68********************************************97 PP
2	Myb_DNA-binding	44.5	3.5e-14	59	104	1	48
TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS Myb_DNA-binding 1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48 rg++T E+++++++ ++lG++ W+ Ia+++ gRt++ +k++w+++l DCAR_019111 59 RGKFTHHEEQIIIHYQALLGNR-WANIAAHLT-GRTDNGVKNYWHTHL 104 89******************.****9.**********986 PP

Protein Features ? help Back to Top

Database	Entry ID	E-value	Start	End	InterPro ID	Description
PROSITE profile	PS51294	17.112	1	53	IPR017930	Myb domain
SuperFamily	SSF46689	9.38E-28	3	100	IPR009057	Homeodomain-like
SMART	SM00717	1.9E-11	5	55	IPR001005	SANT/Myb domain
Pfam	PF00249	4.4E-14	6	53	IPR001005	SANT/Myb domain
Gene3D	G3DSA:1.10.10.60	1.7E-21	8	60	IPR009057	Homeodomain-like
CDD	cd00167	1.33E-10	8	53	No hit	No description
PROSITE profile	PS51294	23.654	54	108	IPR017930	Myb domain
SMART	SM00717	2.5E-12	58	106	IPR001005	SANT/Myb domain
Pfam	PF00249	2.2E-12	59	104	IPR001005	SANT/Myb domain
Gene3D	G3DSA:1.10.10.60	4.0E-23	61	108	IPR009057	Homeodomain-like
CDD	cd00167	1.06E-9	61	104	No hit	No description

Gene Ontology ? help Back to Top
GO Term	GO Category	GO Description
GO:0003677	Molecular Function	DNA binding

Sequence ? help Back to Top
Protein Sequence Length: 210 aa Download sequence Send to blast
MARLPKSRWT LDEDIMLVSY VQEHGASNWS LVPGNAGLNR SGKSCRFRWM NHLRPGINRG 60 KFTHHEEQII IHYQALLGNR WANIAAHLTG RTDNGVKNYW HTHLKKKLDI VNGHVYEPIG 120 NPVAAPALVY QVLPVPAPAL VYRVPPVPAS SFAPGREGFD YPSIARAPSF GPGREGFAYL 180 PIALAPSFAP GRVVFAYPPD IFISAGHES*

3D Structure ? help Back to Top

PDB ID	Evalue	Query Start	Query End	Hit Start	Hit End	Description
1a5j_A	9e-26	4	109	5	109	B-MYB
Search in ModeBase

Functional Description ? help Back to Top
Source	Description
UniProt	Transcription factor that binds specifically to the DNA sequence 5'-AACAAAC-3' (PubMed:19170933). Acts as a positive regulator of hypersensitive cell death (PubMed:10571865, PubMed:12119395). Acts as a positive regulator of salicylic acid synthesis (PubMed:16730712). Regulates very-long-chain fatty acid biosynthesis (PubMed:18326828). Acts cooperatively with BZR2 to promote expression of a subset of brassinosteroids target genes (PubMed:19170933). Transcriptional activity and hypersensitive response control negatively regulated by PLA2-ALPHA and by the Xanthomonas type III effector XopD (AC G9L9K6) (PubMed:20696912, PubMed:21917550). Involved in the regulation of abscisic acid (ABA) signaling (PubMed:22814374). Increased levels of MYB30 can accelerate flowering both in long and short days through the regulation of FT (PubMed:24587042). {ECO:0000269\|PubMed:10571865, ECO:0000269\|PubMed:12119395, ECO:0000269\|PubMed:16730712, ECO:0000269\|PubMed:18326828, ECO:0000269\|PubMed:19170933, ECO:0000269\|PubMed:20696912, ECO:0000269\|PubMed:21917550, ECO:0000269\|PubMed:22814374, ECO:0000269\|PubMed:24587042}.

Regulation -- Description ? help Back to Top
Source	Description
UniProt	INDUCTION: Up-regulated during hypersensitive response, but no expression detected during compatible interaction with pathogens (PubMed:10571865). Specifically induced in the inoculated zone 4 hours post pathogen infection (PubMed:20696912). Up-regulated by jasmonic acid and salicylic acid (PubMed:16463103, PubMed:16730712). Transcriptionally regulated by BZR2 (PubMed:19170933). {ECO:0000269\|PubMed:10571865, ECO:0000269\|PubMed:16463103, ECO:0000269\|PubMed:16730712, ECO:0000269\|PubMed:19170933, ECO:0000269\|PubMed:20696912}.

Regulation -- PlantRegMap ? help Back to Top
Source	Upstream Regulator	Target Gene
PlantRegMap	Retrieve	-

Annotation -- Protein ? help Back to Top
Source	Hit ID	E-value	Description
Refseq	XP_017245833.1	4e-77	PREDICTED: transcription factor MYB30-like
Swissprot	Q9SCU7	8e-47	MYB30_ARATH; Transcription factor MYB30
TrEMBL	A0A164ZFV2	1e-152	A0A164ZFV2_DAUCS; Uncharacterized protein
STRING	XP_010532312.1	7e-47	(Tarenaya hassleriana)
STRING	XP_010546059.1	7e-47	(Tarenaya hassleriana)

Orthologous Group ? help Back to Top
Lineage	Orthologous Group ID	Taxa Number	Gene Number
Asterids	OGEA12	24	2154

Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID	E-value	Description
AT3G28910.1	4e-49	myb domain protein 30

Link Out ? help Back to Top
Phytozome	DCAR_019111

Publications ? help Back to Top
Ding Y, et al. Four distinct types of dehydration stress memory genes in Arabidopsis thaliana. BMC Plant Biol., 2013. 13: p. 229 [PMID:24377444] Kaurilind E,Xu E,Brosché M A genetic framework for H2O2 induced cell death in Arabidopsis thaliana. BMC Genomics, 2015. 16: p. 837 [PMID:26493993] Lee HG,Seo PJ The Arabidopsis MIEL1 E3 ligase negatively regulates ABA signalling by promoting protein turnover of MYB96. Nat Commun, 2016. 7: p. 12525 [PMID:27615387] Serrano I, et al. A non canonical subtilase attenuates the transcriptional activation of defence responses in Arabidopsis thaliana. Elife, 2017. [PMID:27685353] Liao C,Zheng Y,Guo Y MYB30 transcription factor regulates oxidative and heat stress responses through ANNEXIN-mediated cytosolic calcium signaling in Arabidopsis. New Phytol., 2017. 216(1): p. 163-177 [PMID:28726305] Lee HG,Kim J,Suh MC,Seo PJ The MIEL1 E3 Ubiquitin Ligase Negatively Regulates Cuticular Wax Biosynthesis in Arabidopsis Stems. Plant Cell Physiol., 2017. 58(7): p. 1249-1259 [PMID:28838126] Mabuchi K, et al. MYB30 links ROS signaling, root cell elongation, and plant immune responses. Proc. Natl. Acad. Sci. U.S.A., 2018. 115(20): p. E4710-E4719 [PMID:29712840] Zheng Y,Chen Z,Ma L,Liao C The Ubiquitin E3 Ligase RHA2b Promotes Degradation of MYB30 in Abscisic Acid Signaling. Plant Physiol., 2018. 178(1): p. 428-440 [PMID:30030326]