PlantRegMap/PlantTFDB v5.0
Plant Transcription
Factor Database
|
Home TFext BLAST Prediction Download Help About Links PlantRegMap |
Transcription Factor Information
Basic Information? help Back to Top | |||||||||
---|---|---|---|---|---|---|---|---|---|
TF ID | DCAR_019110 | ||||||||
Organism | |||||||||
Taxonomic ID | |||||||||
Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; campanulids; Apiales; Apiineae; Apiaceae; Apioideae; Scandiceae; Daucinae; Daucus
|
||||||||
Family | MYB | ||||||||
Protein Properties | Length: 210aa MW: 23199.5 Da PI: 10.0546 | ||||||||
Description | MYB family protein | ||||||||
Gene Model |
|
Signature Domain? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
No. | Domain | Score | E-value | Start | End | HMM Start | HMM End |
1 | Myb_DNA-binding | 54.8 | 2.2e-17 | 6 | 53 | 1 | 48 |
TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS Myb_DNA-binding 1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48 ++rWT++Ed lv +v+++G +W++++r g++R++k+c+ rw ++l DCAR_019110 6 KDRWTPDEDIVLVSYVQEHGASNWSLVPRNAGLNRSGKSCRFRWMNHL 53 68********************************************97 PP | |||||||
2 | Myb_DNA-binding | 47.6 | 3.9e-15 | 59 | 104 | 1 | 48 |
TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS Myb_DNA-binding 1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48 rg++T E++++++++++lG++ W+ Ia+++ gRt++ +k++w+++l DCAR_019110 59 RGKFTHHEEQIIIHYHALLGNR-WADIAAHLT-GRTDNGVKNYWHTHL 104 89********************.********9.************986 PP |
Protein Features ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Database | Entry ID | E-value | Start | End | InterPro ID | Description |
PROSITE profile | PS51294 | 24.905 | 1 | 57 | IPR017930 | Myb domain |
SuperFamily | SSF46689 | 1.58E-28 | 3 | 100 | IPR009057 | Homeodomain-like |
SMART | SM00717 | 1.6E-13 | 5 | 55 | IPR001005 | SANT/Myb domain |
Pfam | PF00249 | 4.0E-15 | 6 | 53 | IPR001005 | SANT/Myb domain |
CDD | cd00167 | 8.91E-12 | 8 | 53 | No hit | No description |
Gene3D | G3DSA:1.10.10.60 | 4.9E-23 | 8 | 60 | IPR009057 | Homeodomain-like |
SMART | SM00717 | 9.1E-13 | 58 | 106 | IPR001005 | SANT/Myb domain |
PROSITE profile | PS51294 | 19.97 | 58 | 108 | IPR017930 | Myb domain |
Pfam | PF00249 | 1.6E-13 | 59 | 104 | IPR001005 | SANT/Myb domain |
Gene3D | G3DSA:1.10.10.60 | 3.7E-24 | 61 | 108 | IPR009057 | Homeodomain-like |
CDD | cd00167 | 6.75E-10 | 61 | 104 | No hit | No description |
Gene Ontology ? help Back to Top | ||||||
---|---|---|---|---|---|---|
GO Term | GO Category | GO Description | ||||
GO:0003677 | Molecular Function | DNA binding |
Sequence ? help Back to Top |
---|
Protein Sequence Length: 210 aa Download sequence Send to blast |
MVRPKKDRWT PDEDIVLVSY VQEHGASNWS LVPRNAGLNR SGKSCRFRWM NHLRPGINRG 60 KFTHHEEQII IHYHALLGNR WADIAAHLTG RTDNGVKNYW HTHLKKKLDI VNGHVDEPIG 120 NPVAAPALVY QVPPVPAPAL VYRLPPVPAP SFAPGREGFD YPSIARAPSF GPGREGFAYL 180 PIALAPSFAP GRVVFAYPPN IFISAGHES* |
3D Structure ? help Back to Top | ||||||
---|---|---|---|---|---|---|
PDB ID | Evalue | Query Start | Query End | Hit Start | Hit End | Description |
1a5j_A | 2e-27 | 9 | 109 | 10 | 109 | B-MYB |
Search in ModeBase |
Functional Description ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Description | |||||
UniProt | Transcription activator involved in the activation of cuticular wax biosynthesis under drought stress. Binds directly to the promoters of genes involved in cuticular wax biosynthesis. Transactivates WSD1, KCS2/DAISY, CER1, CER2, FAR3 and ECR genes (PubMed:25305760, PubMed:27577115). Functions together with MYB96 in the activation of cuticular wax biosynthesis (PubMed:27577115). {ECO:0000269|PubMed:25305760, ECO:0000269|PubMed:27577115}. |
Regulation -- Description ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Description | |||||
UniProt | INDUCTION: Induced by salt stress, osmotic shock and abscisic acid (ABA). {ECO:0000269|PubMed:25305760}. |
Regulation -- PlantRegMap ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Upstream Regulator | Target Gene | ||||
PlantRegMap | Retrieve | - |
Annotation -- Protein ? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | ||||
Refseq | XP_017245833.1 | 7e-81 | PREDICTED: transcription factor MYB30-like | ||||
Swissprot | Q9SN78 | 9e-49 | MYB94_ARATH; Transcription factor MYB94 | ||||
TrEMBL | A0A164ZFU1 | 1e-151 | A0A164ZFU1_DAUCS; Uncharacterized protein | ||||
STRING | XP_010546059.1 | 3e-49 | (Tarenaya hassleriana) |
Orthologous Group ? help Back to Top | |||
---|---|---|---|
Lineage | Orthologous Group ID | Taxa Number | Gene Number |
Asterids | OGEA12 | 24 | 2154 |
Best hit in Arabidopsis thaliana ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Hit ID | E-value | Description | ||||
AT3G47600.1 | 4e-51 | myb domain protein 94 |
Link Out ? help Back to Top | |
---|---|
Phytozome | DCAR_019110 |
Publications ? help Back to Top | |||
---|---|---|---|
|