PlantRegMap/PlantTFDB v5.0
Plant Transcription
Factor Database
|
Home TFext BLAST Prediction Download Help About Links PlantRegMap |
Transcription Factor Information
Basic Information? help Back to Top | |||||||||
---|---|---|---|---|---|---|---|---|---|
TF ID | DCAR_017715 | ||||||||
Organism | |||||||||
Taxonomic ID | |||||||||
Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; campanulids; Apiales; Apiineae; Apiaceae; Apioideae; Scandiceae; Daucinae; Daucus
|
||||||||
Family | S1Fa-like | ||||||||
Protein Properties | Length: 68aa MW: 7265.7 Da PI: 10.6628 | ||||||||
Description | S1Fa-like family protein | ||||||||
Gene Model |
|
Signature Domain? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
No. | Domain | Score | E-value | Start | End | HMM Start | HMM End |
1 | S1FA | 129.5 | 9.3e-41 | 3 | 67 | 6 | 70 |
S1FA 6 veakGlnPGlivllvvgglllvflvgnyilyvyaqknlPPrkkkPvskkklkreklkqGvavPGe 70 +ea+G+nPGlivllvvggl+ flvgny+lyvyaqknlPPrkkkPvskkklk+eklkqGva+PGe DCAR_017715 3 TEAQGFNPGLIVLLVVGGLVSAFLVGNYALYVYAQKNLPPRKKKPVSKKKLKKEKLKQGVAPPGE 67 79**************************************************************8 PP |
Protein Features ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Database | Entry ID | E-value | Start | End | InterPro ID | Description |
Pfam | PF04689 | 1.3E-37 | 3 | 67 | IPR006779 | DNA binding protein S1FA |
Gene Ontology ? help Back to Top | ||||||
---|---|---|---|---|---|---|
GO Term | GO Category | GO Description | ||||
GO:0006355 | Biological Process | regulation of transcription, DNA-templated | ||||
GO:0005634 | Cellular Component | nucleus | ||||
GO:0003677 | Molecular Function | DNA binding |
Sequence ? help Back to Top |
---|
Protein Sequence Length: 68 aa Download sequence Send to blast |
MDTEAQGFNP GLIVLLVVGG LVSAFLVGNY ALYVYAQKNL PPRKKKPVSK KKLKKEKLKQ 60 GVAPPGE* |
Functional Description ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Description | |||||
UniProt | DNA-binding protein that specifically recognizes a negative element (S1F) within the RPS1 promoter. {ECO:0000250}. |
Regulation -- PlantRegMap ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Upstream Regulator | Target Gene | ||||
PlantRegMap | Retrieve | - |
Annotation -- Protein ? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | ||||
Refseq | XP_017249602.1 | 5e-40 | PREDICTED: DNA-binding protein S1FA-like | ||||
Refseq | XP_017249604.1 | 5e-40 | PREDICTED: DNA-binding protein S1FA-like | ||||
Swissprot | Q42337 | 3e-14 | S1FA2_ARATH; DNA-binding protein S1FA2 | ||||
TrEMBL | A0A162A0Z7 | 1e-38 | A0A162A0Z7_DAUCS; Uncharacterized protein | ||||
STRING | XP_010104121.1 | 8e-26 | (Morus notabilis) |
Orthologous Group ? help Back to Top | |||
---|---|---|---|
Lineage | Orthologous Group ID | Taxa Number | Gene Number |
Asterids | OGEA3174 | 22 | 49 |
Link Out ? help Back to Top | |
---|---|
Phytozome | DCAR_017715 |