PlantRegMap/PlantTFDB v5.0
Plant Transcription
Factor Database
|
Home TFext BLAST Prediction Download Help About Links PlantRegMap |
Transcription Factor Information
Basic Information? help Back to Top | |||||||||
---|---|---|---|---|---|---|---|---|---|
TF ID | DCAR_015312 | ||||||||
Organism | |||||||||
Taxonomic ID | |||||||||
Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; campanulids; Apiales; Apiineae; Apiaceae; Apioideae; Scandiceae; Daucinae; Daucus
|
||||||||
Family | Whirly | ||||||||
Protein Properties | Length: 157aa MW: 17319.8 Da PI: 9.9821 | ||||||||
Description | Whirly family protein | ||||||||
Gene Model |
|
Signature Domain? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
No. | Domain | Score | E-value | Start | End | HMM Start | HMM End |
1 | Whirly | 205.2 | 7.9e-64 | 18 | 155 | 2 | 139 |
Whirly 2 vyktkaalkvkavrptfealdsgnlklkraGglllelanataerkydWekkqsfalsatevaelvdlaskesceffhdpaakgsneGkvrkalkvePl 99 +yk+k al+ +++p+f++ldsg+lk++r+G+++l + +a++erkydWekkq fals+tev++l++l+++++cef+hdp++k+sn+G+vrk+l+v+P+ DCAR_015312 18 IYKGKVALSASPRLPQFSKLDSGSLKVDRQGTIMLSFSPAIGERKYDWEKKQFFALSTTEVGSLISLGPNDTCEFYHDPSMKSSNAGQVRKTLQVKPY 115 9************************************************************************************************* PP Whirly 100 pdGsGlfvnlsvtnslvkgnesfsvPvskaefavlrsllv 139 +dGsG+f++lsv n++++ ++f+vPv++aefav+r++++ DCAR_015312 116 ADGSGYFISLSVVNNILNISDRFTVPVTRAEFAVMRTAFS 155 *************************************995 PP |
Protein Features ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Database | Entry ID | E-value | Start | End | InterPro ID | Description |
Gene3D | G3DSA:2.30.31.10 | 7.4E-65 | 5 | 155 | IPR009044 | ssDNA-binding transcriptional regulator |
SuperFamily | SSF54447 | 1.26E-55 | 9 | 155 | IPR009044 | ssDNA-binding transcriptional regulator |
Pfam | PF08536 | 5.3E-59 | 18 | 152 | IPR013742 | Plant transcription factor |
Gene Ontology ? help Back to Top | ||||||
---|---|---|---|---|---|---|
GO Term | GO Category | GO Description | ||||
GO:0006281 | Biological Process | DNA repair | ||||
GO:0006355 | Biological Process | regulation of transcription, DNA-templated | ||||
GO:0005739 | Cellular Component | mitochondrion | ||||
GO:0003677 | Molecular Function | DNA binding |
Sequence ? help Back to Top |
---|
Protein Sequence Length: 157 aa Download sequence Send to blast |
MQQTLGKLSD RVFANYNIYK GKVALSASPR LPQFSKLDSG SLKVDRQGTI MLSFSPAIGE 60 RKYDWEKKQF FALSTTEVGS LISLGPNDTC EFYHDPSMKS SNAGQVRKTL QVKPYADGSG 120 YFISLSVVNN ILNISDRFTV PVTRAEFAVM RTAFSV* |
3D Structure ? help Back to Top | ||||||
---|---|---|---|---|---|---|
PDB ID | Evalue | Query Start | Query End | Hit Start | Hit End | Description |
3n1h_A | 3e-78 | 6 | 155 | 5 | 154 | StWhy2 |
3n1i_A | 3e-78 | 6 | 155 | 5 | 154 | protein StWhy2 |
3n1j_A | 3e-78 | 6 | 155 | 5 | 154 | Protein StWhy2 |
3n1k_A | 3e-78 | 6 | 155 | 5 | 154 | protein StWhy2 |
3n1l_A | 3e-78 | 6 | 155 | 5 | 154 | protein StWhy2 |
Search in ModeBase |
Functional Description ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Description | |||||
UniProt | Single-stranded DNA-binding protein that may be involved in the maintenance of mitochondrial genome stability by preventing break-induced DNA rearrangements. {ECO:0000269|PubMed:21911368}. |
Regulation -- PlantRegMap ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Upstream Regulator | Target Gene | ||||
PlantRegMap | Retrieve | - |
Annotation -- Protein ? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | ||||
Refseq | XP_017244739.1 | 1e-109 | PREDICTED: single-stranded DNA-bindig protein WHY2, mitochondrial-like isoform X3 | ||||
Swissprot | D9J034 | 2e-77 | WHY2_SOLTU; Single-stranded DNA-binding protein WHY2, mitochondrial | ||||
TrEMBL | A0A165WAJ7 | 1e-112 | A0A165WAJ7_DAUCS; Uncharacterized protein | ||||
STRING | XP_009772771.1 | 2e-78 | (Nicotiana sylvestris) | ||||
STRING | XP_009598355.1 | 2e-78 | (Nicotiana tomentosiformis) |
Orthologous Group ? help Back to Top | |||
---|---|---|---|
Lineage | Orthologous Group ID | Taxa Number | Gene Number |
Asterids | OGEA9782 | 22 | 28 |
Best hit in Arabidopsis thaliana ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Hit ID | E-value | Description | ||||
AT1G71260.1 | 2e-77 | WHIRLY 2 |
Link Out ? help Back to Top | |
---|---|
Phytozome | DCAR_015312 |