PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID DCAR_015312
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; campanulids; Apiales; Apiineae; Apiaceae; Apioideae; Scandiceae; Daucinae; Daucus
Family Whirly
Protein Properties Length: 157aa    MW: 17319.8 Da    PI: 9.9821
Description Whirly family protein
Gene Model
Gene Model ID Type Source Coding Sequence
DCAR_015312genomeARS-USDAView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Whirly205.27.9e-64181552139
       Whirly   2 vyktkaalkvkavrptfealdsgnlklkraGglllelanataerkydWekkqsfalsatevaelvdlaskesceffhdpaakgsneGkvrkalkvePl 99 
                  +yk+k al+  +++p+f++ldsg+lk++r+G+++l + +a++erkydWekkq fals+tev++l++l+++++cef+hdp++k+sn+G+vrk+l+v+P+
  DCAR_015312  18 IYKGKVALSASPRLPQFSKLDSGSLKVDRQGTIMLSFSPAIGERKYDWEKKQFFALSTTEVGSLISLGPNDTCEFYHDPSMKSSNAGQVRKTLQVKPY 115
                  9************************************************************************************************* PP

       Whirly 100 pdGsGlfvnlsvtnslvkgnesfsvPvskaefavlrsllv 139
                  +dGsG+f++lsv n++++  ++f+vPv++aefav+r++++
  DCAR_015312 116 ADGSGYFISLSVVNNILNISDRFTVPVTRAEFAVMRTAFS 155
                  *************************************995 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:2.30.31.107.4E-655155IPR009044ssDNA-binding transcriptional regulator
SuperFamilySSF544471.26E-559155IPR009044ssDNA-binding transcriptional regulator
PfamPF085365.3E-5918152IPR013742Plant transcription factor
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006281Biological ProcessDNA repair
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0005739Cellular Componentmitochondrion
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 157 aa     Download sequence    Send to blast
MQQTLGKLSD RVFANYNIYK GKVALSASPR LPQFSKLDSG SLKVDRQGTI MLSFSPAIGE  60
RKYDWEKKQF FALSTTEVGS LISLGPNDTC EFYHDPSMKS SNAGQVRKTL QVKPYADGSG  120
YFISLSVVNN ILNISDRFTV PVTRAEFAVM RTAFSV*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
3n1h_A3e-7861555154StWhy2
3n1i_A3e-7861555154protein StWhy2
3n1j_A3e-7861555154Protein StWhy2
3n1k_A3e-7861555154protein StWhy2
3n1l_A3e-7861555154protein StWhy2
Search in ModeBase
Functional Description ? help Back to Top
Source Description
UniProtSingle-stranded DNA-binding protein that may be involved in the maintenance of mitochondrial genome stability by preventing break-induced DNA rearrangements. {ECO:0000269|PubMed:21911368}.
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_017244739.11e-109PREDICTED: single-stranded DNA-bindig protein WHY2, mitochondrial-like isoform X3
SwissprotD9J0342e-77WHY2_SOLTU; Single-stranded DNA-binding protein WHY2, mitochondrial
TrEMBLA0A165WAJ71e-112A0A165WAJ7_DAUCS; Uncharacterized protein
STRINGXP_009772771.12e-78(Nicotiana sylvestris)
STRINGXP_009598355.12e-78(Nicotiana tomentosiformis)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
AsteridsOGEA97822228
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G71260.12e-77WHIRLY 2