PlantRegMap/PlantTFDB v5.0
Plant Transcription
Factor Database
|
Home TFext BLAST Prediction Download Help About Links PlantRegMap |
Transcription Factor Information
Basic Information? help Back to Top | |||||||||
---|---|---|---|---|---|---|---|---|---|
TF ID | DCAR_014567 | ||||||||
Organism | |||||||||
Taxonomic ID | |||||||||
Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; campanulids; Apiales; Apiineae; Apiaceae; Apioideae; Scandiceae; Daucinae; Daucus
|
||||||||
Family | NAC | ||||||||
Protein Properties | Length: 154aa MW: 17645.1 Da PI: 9.6567 | ||||||||
Description | NAC family protein | ||||||||
Gene Model |
|
Signature Domain? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
No. | Domain | Score | E-value | Start | End | HMM Start | HMM End |
1 | NAM | 162.2 | 2e-50 | 9 | 138 | 1 | 128 |
NAM 1 lppGfrFhPtdeelvveyLkkkvegkkleleevikevdiykvePwdLp..kkvkaeekewyfFskrdkkyatgkrknratksgyWkatgkdkevlsk. 95 lp+G+rF+Ptdeel+++yL+ k++g + e+ +vi+evd++k+ePwdLp + +++ ++ew+fF+++d+ky++g+r+nrat +gyWkatgkd+ ++s DCAR_014567 9 LPVGYRFRPTDEELINHYLRLKINGFHSEV-SVIREVDVCKCEPWDLPdlSLIHSIDNEWFFFCPKDRKYQNGQRANRATVAGYWKATGKDRFIKSGk 105 799************************999.99**************96447777899*************************************974 PP NAM 96 kgelvglkktLvfykgrapkgektdWvmheyrl 128 + +++g kktLvfy+grap+ge+t+Wv+hey++ DCAR_014567 106 GLNVIGRKKTLVFYTGRAPRGERTHWVIHEYSA 138 5567***************************86 PP |
Protein Features ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Database | Entry ID | E-value | Start | End | InterPro ID | Description |
SuperFamily | SSF101941 | 4.45E-54 | 5 | 143 | IPR003441 | NAC domain |
PROSITE profile | PS51005 | 50.492 | 9 | 153 | IPR003441 | NAC domain |
Pfam | PF02365 | 2.1E-26 | 10 | 137 | IPR003441 | NAC domain |
Gene Ontology ? help Back to Top | ||||||
---|---|---|---|---|---|---|
GO Term | GO Category | GO Description | ||||
GO:0006355 | Biological Process | regulation of transcription, DNA-templated | ||||
GO:0003677 | Molecular Function | DNA binding |
Sequence ? help Back to Top |
---|
Protein Sequence Length: 154 aa Download sequence Send to blast |
MAVRPEGNLP VGYRFRPTDE ELINHYLRLK INGFHSEVSV IREVDVCKCE PWDLPDLSLI 60 HSIDNEWFFF CPKDRKYQNG QRANRATVAG YWKATGKDRF IKSGKGLNVI GRKKTLVFYT 120 GRAPRGERTH WVIHEYSATD EALSGTRPGQ VHI* |
3D Structure ? help Back to Top | ||||||
---|---|---|---|---|---|---|
PDB ID | Evalue | Query Start | Query End | Hit Start | Hit End | Description |
3ulx_A | 7e-42 | 6 | 136 | 12 | 138 | Stress-induced transcription factor NAC1 |
Search in ModeBase |
Functional Description ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Description | |||||
UniProt | Transcriptional activator activated by proteolytic cleavage through regulated intramembrane proteolysis (RIP) (PubMed:18443413, PubMed:24329768). Calmodulin-regulated transcriptional repressor. Binds several synthetic promoters with randomly selected binding sites (PubMed:17947243). Functions synergistically with SNI1 as negative regulator of pathogen-induced PR1 expression and basal resistance to a virulent strain of P.syringae. Binds directly to the promoter of the PR1 gene (PubMed:22826500). Acts as positive regulator of innate immunity. Involved in the effector-triggered immunity (ETI) induction of immunity-related gene expression (PubMed:24329768). Mediates osmotic stress signaling in leaf senescence by up-regulating senescence-associated genes (PubMed:18443413). {ECO:0000269|PubMed:17947243, ECO:0000269|PubMed:18443413, ECO:0000269|PubMed:22826500, ECO:0000269|PubMed:24329768}. |
Regulation -- PlantRegMap ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Upstream Regulator | Target Gene | ||||
PlantRegMap | Retrieve | - |
Annotation -- Protein ? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | ||||
Refseq | XP_017246099.1 | 1e-113 | PREDICTED: NAC domain-containing protein 62-like | ||||
Swissprot | F4JN35 | 1e-68 | NTL9_ARATH; Protein NTM1-like 9 | ||||
TrEMBL | A0A165XE21 | 1e-111 | A0A165XE21_DAUCS; Uncharacterized protein | ||||
STRING | XP_009759914.1 | 2e-76 | (Nicotiana sylvestris) |
Orthologous Group ? help Back to Top | |||
---|---|---|---|
Lineage | Orthologous Group ID | Taxa Number | Gene Number |
Asterids | OGEA3363 | 24 | 48 |
Best hit in Arabidopsis thaliana ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Hit ID | E-value | Description | ||||
AT4G35580.1 | 6e-71 | NAC transcription factor-like 9 |
Link Out ? help Back to Top | |
---|---|
Phytozome | DCAR_014567 |
Publications ? help Back to Top | |||
---|---|---|---|
|