PlantTFDB - Plant Transcription Factor Database @ CBI, PKU

PlantRegMap/PlantTFDB v5.0

Plant Transcription Factor Database

Transcription Factor Information

Basic Information | Signature Domain | Sequence |

Basic Information? help Back to Top

TF ID

DCAR_011126

Organism

Daucus carota

Taxonomic ID

4039

Taxonomic Lineage

cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; campanulids; Apiales; Apiineae; Apiaceae; Apioideae; Scandiceae; Daucinae; Daucus

Family

ZF-HD

Protein Properties

Length: 92aa MW: 9670.67 Da PI: 6.4856

Description

ZF-HD family protein

Gene Model

Gene Model ID	Type	Source	Coding Sequence
DCAR_011126	genome	ARS-USDA	View CDS

Signature Domain? help Back to Top

No.	Domain	Score	E-value	Start	End	HMM Start	HMM End
1	ZF-HD_dimer	81.5	1e-25	32	86	3	57
ZF-HD_dimer 3 kvrYkeClkNhAaslGghavDGCgEfmpsegeegtaaalkCaACgCHRnFHRrev 57 v+Y eC+kN A s GghavDGC+Ef+ s geeg +++l C ACgC R+FHRr v DCAR_011126 32 VVTYLECQKNVAESAGGHAVDGCQEFIGSGGEEGAPSTLICGACGCNRSFHRRLV 86 689************************9999*****************965 PP

Protein Features ? help Back to Top

Database	Entry ID	E-value	Start	End	InterPro ID	Description
ProDom	PD125774	5.0E-14	33	86	IPR006456	ZF-HD homeobox protein, Cys/His-rich dimerisation domain
Pfam	PF04770	7.9E-23	33	85	IPR006456	ZF-HD homeobox protein, Cys/His-rich dimerisation domain
TIGRFAMs	TIGR01566	5.3E-22	34	84	IPR006456	ZF-HD homeobox protein, Cys/His-rich dimerisation domain
PROSITE profile	PS51523	21.742	35	85	IPR006456	ZF-HD homeobox protein, Cys/His-rich dimerisation domain

Sequence ? help Back to Top
Protein Sequence Length: 92 aa Download sequence Send to blast
MKRSNPRGES VNRLNPRGNG DNENFVNTQA TVVTYLECQK NVAESAGGHA VDGCQEFIGS 60 GGEEGAPSTL ICGACGCNRS FHRRLVTVLS E*

Functional Description ? help Back to Top
Source	Description
UniProt	Inhibits zinc finger homeodomain (ZHD) transcription factors by interacting with them to prevent both their nuclear localization and their DNA-binding properties. Involved in integrating signals from multiple hormones by regulating the expression of specific genes. {ECO:0000269\|PubMed:21455630}.

Regulation -- PlantRegMap ? help Back to Top
Source	Upstream Regulator	Target Gene
PlantRegMap	Retrieve	-

Annotation -- Protein ? help Back to Top
Source	Hit ID	E-value	Description
Refseq	XP_008353421.1	8e-20	mini zinc finger protein 2-like
Swissprot	Q9LJW5	5e-18	MIF2_ARATH; Mini zinc finger protein 2
TrEMBL	A0A166B4G8	6e-60	A0A166B4G8_DAUCS; Uncharacterized protein
STRING	XP_008353421.1	3e-19	(Malus domestica)

Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID	E-value	Description
AT3G28917.1	2e-20	mini zinc finger 2

Link Out ? help Back to Top
Phytozome	DCAR_011126

Publications ? help Back to Top
Bollier N, et al. At-MINI ZINC FINGER2 and Sl-INHIBITOR OF MERISTEM ACTIVITY, a Conserved Missing Link in the Regulation of Floral Meristem Termination in Arabidopsis and Tomato. Plant Cell, 2018. 30(1): p. 83-100 [PMID:29298836]