PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID DCAR_007135
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; campanulids; Apiales; Apiineae; Apiaceae; Apioideae; Scandiceae; Daucinae; Daucus
Family Whirly
Protein Properties Length: 268aa    MW: 29708.6 Da    PI: 9.6788
Description Whirly family protein
Gene Model
Gene Model ID Type Source Coding Sequence
DCAR_007135genomeARS-USDAView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Whirly122.13.3e-3893176184
       Whirly   1 svyktkaalkvkavrptfealdsgnlklkraGglllelanataerkydWekkqsfalsatevaelvdlaskesceffhdpaakg 84 
                  s+yk+kaal+v++++p+f  ldsg+ kl+r+G +ll++a+a+++r+ydW++kq+f ls te+++l++l++k+sceffhdp++++
  DCAR_007135  93 SIYKGKAALTVEPRAPEFAPLDSGSYKLSREGCVLLQFAPAASVRQYDWSRKQVFLLSITEIGTLMSLGAKDSCEFFHDPFKGK 176
                  7********************************************************************************986 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:2.30.31.101.6E-5781248IPR009044ssDNA-binding transcriptional regulator
SuperFamilySSF544478.63E-5985267IPR009044ssDNA-binding transcriptional regulator
PfamPF085361.6E-4094225IPR013742Plant transcription factor
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006281Biological ProcessDNA repair
GO:0032211Biological Processnegative regulation of telomere maintenance via telomerase
GO:0045893Biological Processpositive regulation of transcription, DNA-templated
GO:0045910Biological Processnegative regulation of DNA recombination
GO:0009508Cellular Componentplastid chromosome
GO:0009570Cellular Componentchloroplast stroma
GO:0003697Molecular Functionsingle-stranded DNA binding
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0003723Molecular FunctionRNA binding
GO:0042162Molecular Functiontelomeric DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 268 aa     Download sequence    Send to blast
MLNHTLSQPS STSGFSSILN PNHLHTKLSS HLHYSFSLNP KKSKTPFPNK LSVNRSPHFE  60
HFHHQNNNFT ATKSSLSPPA TGSASPRFFV GHSIYKGKAA LTVEPRAPEF APLDSGSYKL  120
SREGCVLLQF APAASVRQYD WSRKQVFLLS ITEIGTLMSL GAKDSCEFFH DPFKGKRLCL  180
LPPELNFYSS QNLNQPNAGV QNKLANMDES IYIPVTRAEL TVLVSAFNFL VPYLLGWHAY  240
ADSIKPDDLT RGNNANPRAG ADFEWSR*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1l3a_A4e-868226532218p24: plant transcriptional regulator PBF-2
1l3a_B4e-868226532218p24: plant transcriptional regulator PBF-2
1l3a_C4e-868226532218p24: plant transcriptional regulator PBF-2
1l3a_D4e-868226532218p24: plant transcriptional regulator PBF-2
Search in ModeBase
Functional Description ? help Back to Top
Source Description
UniProtSingle-stranded DNA-binding protein that acts as a transcriptional activator of the pathogenesis-related gene PR-10a. Upon elicitation, binds a 30bp promoter sequence known as elicitor element response (ERE) and is required for PR-10a expression. {ECO:0000269|PubMed:10948264, ECO:0000269|PubMed:12080340, ECO:0000269|PubMed:14960277}.
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_017232397.11e-176PREDICTED: single-stranded DNA-binding protein WHY1, chloroplastic
SwissprotQ9LL852e-89WHY1_SOLTU; Single-stranded DNA-binding protein WHY1, chloroplastic
TrEMBLA0A166EAC20.0A0A166EAC2_DAUCS; Uncharacterized protein
STRINGEOY020453e-90(Theobroma cacao)
STRINGcassava4.1_013407m6e-90(Manihot esculenta)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
AsteridsOGEA77312430
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G14410.17e-87ssDNA-binding transcriptional regulator