PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID DCAR_006333
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; campanulids; Apiales; Apiineae; Apiaceae; Apioideae; Scandiceae; Daucinae; Daucus
Family MYB
Protein Properties Length: 218aa    MW: 24851.8 Da    PI: 6.0442
Description MYB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
DCAR_006333genomeARS-USDAView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding25.72.7e-081962344
                     SS-HHHHHHHHHHHHHTTTT...-HHHHHHHHTTTS-HHHHHHHH CS
  Myb_DNA-binding  3 rWTteEdellvdavkqlGgg...tWktIartmgkgRtlkqcksrw 44
                      W+  +d+l+ +a  +++ +   +W +Ia+ ++ g+t+++++ ++
      DCAR_006333 19 EWSRFDDKLFEKALVMFPEDmpnRWQKIAEQVP-GKTAEDVRVHY 62
                     69999*************99*************.********999 PP

2Myb_DNA-binding43.47.7e-14116160347
                      SS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHH CS
  Myb_DNA-binding   3 rWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqky 47 
                      +WT+eE+ l++ +  ++G+g+W++I+r +  +Rt+ q+ s+ qky
      DCAR_006333 116 PWTEEEHRLFLIGLDRYGKGDWRSISRNVVVTRTPTQVASHAQKY 160
                      8*******************************************9 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS512948.5561270IPR017930Myb domain
SMARTSM007179.8E-81668IPR001005SANT/Myb domain
PfamPF002492.7E-71962IPR001005SANT/Myb domain
CDDcd001672.37E-71966No hitNo description
SuperFamilySSF466891.87E-111974IPR009057Homeodomain-like
Gene3DG3DSA:1.10.10.602.2E-52067IPR009057Homeodomain-like
PROSITE profilePS5129419.885109165IPR017930Myb domain
SuperFamilySSF466896.42E-17111166IPR009057Homeodomain-like
TIGRFAMsTIGR015571.4E-16112164IPR006447Myb domain, plants
Gene3DG3DSA:1.10.10.603.8E-11113159IPR009057Homeodomain-like
SMARTSM007172.6E-10113163IPR001005SANT/Myb domain
PfamPF002498.4E-12116160IPR001005SANT/Myb domain
CDDcd001674.37E-9116160No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 218 aa     Download sequence    Send to blast
MYNTNREDEQ WMMSAGGVEW SRFDDKLFEK ALVMFPEDMP NRWQKIAEQV PGKTAEDVRV  60
HYDALLHDVL EIDSGRVELP KYPDDGFLGF QETGANQISF GAKAKQGDGD RKKGTPWTEE  120
EHRLFLIGLD RYGKGDWRSI SRNVVVTRTP TQVASHAQKY YLRQNSMKKE RKRSSIHDIT  180
TNVDTQPIPA PSNFTNQGDT MGYQNVRLPV LEDQIGG*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
2cjj_A5e-141786877RADIALIS
Search in ModeBase
Functional Description ? help Back to Top
Source Description
UniProtInvolved in the dorsovental asymmetry of flowers. Promotes ventral identity. {ECO:0000269|PubMed:11937495, ECO:0000269|PubMed:9118809}.
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00055PBMTransfer from AT5G04760Download
Motif logo
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieveRetrieve
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_017231997.11e-163PREDICTED: transcription factor DIVARICATA-like
SwissprotQ8S9H72e-57DIV_ANTMA; Transcription factor DIVARICATA
TrEMBLA0A166DP501e-161A0A166DP50_DAUCS; Uncharacterized protein
STRINGXP_009796939.13e-94(Nicotiana sylvestris)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
AsteridsOGEA45472241
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G04760.16e-76MYB family protein
Publications ? help Back to Top
  1. Galego L,Almeida J
    Role of DIVARICATA in the control of dorsoventral asymmetry in Antirrhinum flowers.
    Genes Dev., 2002. 16(7): p. 880-91
    [PMID:11937495]
  2. Almeida J,Rocheta M,Galego L
    Genetic control of flower shape in Antirrhinum majus.
    Development, 1997. 124(7): p. 1387-92
    [PMID:9118809]