PlantTFDB - Plant Transcription Factor Database @ CBI, PKU

PlantRegMap/PlantTFDB v5.0

Plant Transcription Factor Database

Transcription Factor Information

Basic Information | Signature Domain | Sequence |

Basic Information? help Back to Top

TF ID

DCAR_005684

Organism

Daucus carota

Taxonomic ID

4039

Taxonomic Lineage

cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; campanulids; Apiales; Apiineae; Apiaceae; Apioideae; Scandiceae; Daucinae; Daucus

Family

NAC

Protein Properties

Length: 150aa MW: 17260.8 Da PI: 9.616

Description

NAC family protein

Gene Model

Gene Model ID	Type	Source	Coding Sequence
DCAR_005684	genome	ARS-USDA	View CDS

Signature Domain? help Back to Top

No.	Domain	Score	E-value	Start	End	HMM Start	HMM End
1	NAM	165.5	1.8e-51	10	138	1	129
NAM 1 lppGfrFhPtdeelvveyLkkkvegkkleleevikevdiykvePwdLpkkvkaeekewyfFskrdkkyatgkrknratksgyWkatgkdkevlsk.kg 97 lppGfrF P+deelv++yL+kk++++++ ++ e+d++++ePw+Lp+ +k +++ewyfFs rd+kyatg r+nrat+sgyWkatgkd++v + +g DCAR_005684 10 LPPGFRFYPSDEELVCHYLHKKITNEEVLK-GTLVEIDLHTCEPWQLPEVAKLNSTEWYFFSFRDRKYATGFRTNRATTSGYWKATGKDRTVADPnTG 106 79**********************9655.78***********88888999*********************************99678 PP NAM 98 elvglkktLvfykgrapkgektdWvmheyrle 129 + vg++ktLvfyk+rap+g kt W+mhe+rle DCAR_005684 107 AIVGMRKTLVFYKNRAPNGIKTGWIMHEFRLE 138 88*************************985 PP

Protein Features ? help Back to Top

Database	Entry ID	E-value	Start	End	InterPro ID	Description
SuperFamily	SSF101941	8.24E-57	8	142	IPR003441	NAC domain
PROSITE profile	PS51005	53.103	10	149	IPR003441	NAC domain
Pfam	PF02365	7.4E-29	11	137	IPR003441	NAC domain

Gene Ontology ? help Back to Top
GO Term	GO Category	GO Description
GO:0006355	Biological Process	regulation of transcription, DNA-templated
GO:0003677	Molecular Function	DNA binding

Sequence ? help Back to Top
Protein Sequence Length: 150 aa Download sequence Send to blast
MGLRDIGAEL PPGFRFYPSD EELVCHYLHK KITNEEVLKG TLVEIDLHTC EPWQLPEVAK 60 LNSTEWYFFS FRDRKYATGF RTNRATTSGY WKATGKDRTV ADPNTGAIVG MRKTLVFYKN 120 RAPNGIKTGW IMHEFRLESP HLPPKRKID*

3D Structure ? help Back to Top

PDB ID	Evalue	Query Start	Query End	Hit Start	Hit End	Description
3ulx_A	2e-45	1	137	1	140	Stress-induced transcription factor NAC1
Search in ModeBase

Functional Description ? help Back to Top
Source	Description
UniProt	Transcription activator. Involved in molecular mechanisms regulating shoot apical meristem (SAM) formation during embryogenesis and organ separation. Required for axillary meristem initiation and separation of the meristem from the main stem. May act as an inhibitor of cell division. {ECO:0000269\|PubMed:12837947, ECO:0000269\|PubMed:17122068}.

Regulation -- Description ? help Back to Top
Source	Description
UniProt	INDUCTION: By BRM, at the chromatin level, and conferring a very specific spatial expression pattern. {ECO:0000269\|PubMed:16854978}.

Regulation -- PlantRegMap ? help Back to Top
Source	Upstream Regulator	Target Gene
PlantRegMap	Retrieve	-

Annotation -- Protein ? help Back to Top
Source	Hit ID	E-value	Description
Refseq	XP_017233836.1	1e-106	PREDICTED: protein CUP-SHAPED COTYLEDON 3-like
Swissprot	Q9S851	4e-56	NAC31_ARATH; Protein CUP-SHAPED COTYLEDON 3
TrEMBL	A0A161Y662	1e-108	A0A161Y662_DAUCS; Uncharacterized protein
STRING	EOX94424	6e-98	(Theobroma cacao)
STRING	Lus10022915	1e-97	(Linum usitatissimum)

Orthologous Group ? help Back to Top
Lineage	Orthologous Group ID	Taxa Number	Gene Number
Asterids	OGEA1882	24	66

Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID	E-value	Description
AT4G28530.1	5e-83	NAC domain containing protein 74

Link Out ? help Back to Top
Phytozome	DCAR_005684

Publications ? help Back to Top
Chen C, et al. Transcriptome profiling reveals roles of meristem regulators and polarity genes during fruit trichome development in cucumber (Cucumis sativus L.). J. Exp. Bot., 2014. 65(17): p. 4943-58 [PMID:24962999] Gonçalves B, et al. A conserved role for CUP-SHAPED COTYLEDON genes during ovule development. Plant J., 2015. 83(4): p. 732-42 [PMID:26119568] Balkunde R,Kitagawa M,Xu XM,Wang J,Jackson D SHOOT MERISTEMLESS trafficking controls axillary meristem formation, meristem size and organ boundaries in Arabidopsis. Plant J., 2017. 90(3): p. 435-446 [PMID:28161901] Espinosa-Ruiz A, et al. TOPLESS mediates brassinosteroid control of shoot boundaries and root meristem development in Arabidopsis thaliana. Development, 2017. 144(9): p. 1619-1628 [PMID:28320734] Koyama T,Sato F,Ohme-Takagi M Roles of miR319 and TCP Transcription Factors in Leaf Development. Plant Physiol., 2017. 175(2): p. 874-885 [PMID:28842549]