PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID DCAR_004170
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; campanulids; Apiales; Apiineae; Apiaceae; Apioideae; Scandiceae; Daucinae; Daucus
Family BBR-BPC
Protein Properties Length: 287aa    MW: 31690.3 Da    PI: 10.2814
Description BBR-BPC family protein
Gene Model
Gene Model ID Type Source Coding Sequence
DCAR_004170genomeARS-USDAView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1GAGA_bind334.43.1e-10212861301
    GAGA_bind   1 mdddgsrernkgyyepaaslkenlglqlmssia..erdaki..rernlalsekkaavaerd.........maflqrdkalaernkalverdnkllall 85 
                  mdddg + rn+gyyep+  +ke+lglqlms i    rd+k+   +r+  + + ++a+++r+         m++++rd++++          ++l+++l
  DCAR_004170   1 MDDDGLNMRNWGYYEPS--FKEHLGLQLMSPIGgdHRDTKPflSSRDPVMLNANGAYHPRNcvvseapvpMNYMMRDSWIQR---------DRLMHVL 87 
                  9*****99*******99..*************8878****9998899999******************************99.........8899999 PP

    GAGA_bind  86 lvenslasalpvgvqvlsgtksidslqqlsepqledsavelreeeklealpieeaaeeakekkkkkkrqrakkpkekkakkkkkksekskkkvkkesa 183
                  + + s         +v ++++s +++q         ++++   ++++ ++ ++    +   + ++kkrq + +pk+++ kk+kk +++s+++ k+++ 
  DCAR_004170  88 PGNSS--------FGVNPEAHSSHTMQI-------MQPMDSLSKDQVLTEDVKPDIRKGGSSGHTKKRQGPVTPKAPRVKKPKKGPAVSNDNRKSST- 169
                  95554........677788888888887.......23444444455666777778888999999999*****************8888877776666. PP

    GAGA_bind 184 derskaekksidlvlngvslDestlPvPvCsCtGalrqCYkWGnGGWqSaCCtttiSvyPLPvstkrrgaRiagrKmSqgafkklLekLaaeGydlsn 281
                   +r ka kks+++v+ng+++D+s++P+PvCsCtG+++qCYkWG+GGWqSaCCtttiS+yPLP+stkrrg+RiagrKmSqgafkk+LekLa+eGy+++n
  DCAR_004170 170 -QRPKAVKKSVEVVINGIDMDISGIPTPVCSCTGTPQQCYKWGCGGWQSACCTTTISTYPLPMSTKRRGSRIAGRKMSQGAFKKVLEKLASEGYNFGN 266
                  .79*********************************************************************************************** PP

    GAGA_bind 282 pvDLkdhWAkHGtnkfvtir 301
                  ++DLk+hWAkHGtnkfvtir
  DCAR_004170 267 AIDLKSHWAKHGTNKFVTIR 286
                  *******************8 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM012267.8E-1581286IPR010409GAGA-binding transcriptional activator
PfamPF062171.7E-1091286IPR010409GAGA-binding transcriptional activator
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0009723Biological Processresponse to ethylene
GO:0050793Biological Processregulation of developmental process
GO:0005634Cellular Componentnucleus
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 287 aa     Download sequence    Send to blast
MDDDGLNMRN WGYYEPSFKE HLGLQLMSPI GGDHRDTKPF LSSRDPVMLN ANGAYHPRNC  60
VVSEAPVPMN YMMRDSWIQR DRLMHVLPGN SSFGVNPEAH SSHTMQIMQP MDSLSKDQVL  120
TEDVKPDIRK GGSSGHTKKR QGPVTPKAPR VKKPKKGPAV SNDNRKSSTQ RPKAVKKSVE  180
VVINGIDMDI SGIPTPVCSC TGTPQQCYKW GCGGWQSACC TTTISTYPLP MSTKRRGSRI  240
AGRKMSQGAF KKVLEKLASE GYNFGNAIDL KSHWAKHGTN KFVTIR*
Functional Description ? help Back to Top
Source Description
UniProtTranscriptional regulator that specifically binds to GA-rich elements (GAGA-repeats) present in regulatory sequences of genes involved in developmental processes. Negatively regulates the homeotic gene AGL11/STK, which controls ovule primordium identity, by a cooperative binding to purine-rich elements present in the regulatory sequence leading to DNA conformational changes. {ECO:0000269|PubMed:14731261, ECO:0000269|PubMed:15722463}.
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00253DAPTransfer from AT2G01930Download
Motif logo
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieveRetrieve
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_017231430.10.0PREDICTED: protein BASIC PENTACYSTEINE1-like
SwissprotQ9SKD01e-100BPC1_ARATH; Protein BASIC PENTACYSTEINE1
TrEMBLA0A166IUT00.0A0A166IUT0_DAUCS; Uncharacterized protein
STRINGXP_010105533.11e-134(Morus notabilis)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
AsteridsOGEA90612429
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G01930.21e-102basic pentacysteine1