PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID DCAR_002524
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; campanulids; Apiales; Apiineae; Apiaceae; Apioideae; Scandiceae; Daucinae; Daucus
Family MYB
Protein Properties Length: 351aa    MW: 39542.9 Da    PI: 4.7572
Description MYB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
DCAR_002524genomeARS-USDAView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding51.13.2e-163683148
                     TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
  Myb_DNA-binding  1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48
                     rg+WT eEd  l +++ q G g+W++ ar  g++Rt+k+c++rw++yl
      DCAR_002524 36 RGPWTIEEDFALMNYISQNGEGRWNSLARSAGLKRTGKSCRLRWLNYL 83
                     89********************************************97 PP

2Myb_DNA-binding51.13.1e-1689132146
                      TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHH CS
  Myb_DNA-binding   1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqk 46 
                      rg+ T eE++l+++++ ++G++ W++Ia++++ gRt++++k++w++
      DCAR_002524  89 RGNITLEEQLLILELHSRWGNR-WSKIAQHLP-GRTDNEIKNYWRT 132
                      7999******************.*********.***********96 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5129416.2823183IPR017930Myb domain
SuperFamilySSF466894.49E-3034130IPR009057Homeodomain-like
SMARTSM007171.6E-113585IPR001005SANT/Myb domain
PfamPF002492.8E-143683IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.605.1E-213790IPR009057Homeodomain-like
CDDcd001676.92E-103883No hitNo description
PROSITE profilePS5129423.24684138IPR017930Myb domain
SMARTSM007171.3E-1488136IPR001005SANT/Myb domain
PfamPF002496.2E-1589132IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.609.8E-2391137IPR009057Homeodomain-like
CDDcd001675.80E-8109132No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 351 aa     Download sequence    Send to blast
MDVKGERNSE EIVPMMMNNS SDDQEDEMMM EEDLRRGPWT IEEDFALMNY ISQNGEGRWN  60
SLARSAGLKR TGKSCRLRWL NYLRPDVRRG NITLEEQLLI LELHSRWGNR WSKIAQHLPG  120
RTDNEIKNYW RTRVQKHAKQ LKCDVNSKQF KDTMRYLWMP RLVERIQAAG GNTGACSAAA  180
PGESSLAIAT GDSSFTTANP TCYNTNNISN SGFSSQVMVP QTNGMMYNSY EGMIQSSMNN  240
SSSFTPANSG TTGSSDSFGR SQVSPVSDMT DCYNYPPVNP KPNQDYYFQD QLGFTDTLVS  300
PMGYYNSNAG FQCMEPNTSN PWMDGGDLSD NLWSVEDMCL LSQQFNNNNI *
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1a5j_A3e-25331364106B-MYB
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_017234216.10.0PREDICTED: transcription factor MYB108
TrEMBLA0A169WTJ00.0A0A169WTJ0_DAUCS; Uncharacterized protein
STRINGPOPTR_0010s15970.11e-125(Populus trichocarpa)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
AsteridsOGEA13972375
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G06490.12e-84myb domain protein 108